Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF TT1020 FROM THERMUS THERMOPHILUS HB8
 
Authors :  H. Wang, H. Sakai, C. Takemoto-Hori, T. Kaminishi, T. Terada, S. Kuramitsu, M. Shirouzu, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  27 Jan 04  (Deposition) - 11 Jan 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Structural Genomics, Riken Structural Genomics/Proteomics Initiative, Rsgi, Nppsfa, National Project On Protein Structural And Functional Analyses, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Sakai, H. Wang, C. Takemoto-Hori, T. Kaminishi, H. Yamaguchi, Y. Kamewari, T. Terada, S. Kuramitsu, M. Shirouzu, S. Yokoyama
Crystal Structures Of The Signal Transducing Protein Glnk From Thermus Thermophilus Hb8.
J. Struct. Biol. V. 149 99 2005
PubMed-ID: 15629661  |  Reference-DOI: 10.1016/J.JSB.2004.08.007
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NITROGEN REGULATORY PROTEIN PII
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET26B(+)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid274

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric/Biological Unit (1, 3)
No.NameCountTypeFull Name
1ADP3Ligand/IonADENOSINE-5'-DIPHOSPHATE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:7 , GLY A:35 , HIS A:36 , GLY A:37 , LYS A:58 , GLU A:85 , VAL A:86 , GLY A:87 , ASP A:88 , GLY A:89 , LYS A:90 , HOH A:203 , HOH A:231 , GLY B:27 , LEU B:28 , THR B:29 , GLU B:62 , ILE B:63 , GLY B:64 , ARG B:101 , ARG B:103 , HOH B:325BINDING SITE FOR RESIDUE ADP A 200
2AC2SOFTWAREILE B:7 , GLY B:35 , HIS B:36 , GLY B:37 , LYS B:58 , VAL B:86 , GLY B:87 , ASP B:88 , GLY B:89 , LYS B:90 , HOH B:313 , HOH B:314 , HOH B:324 , GLY C:27 , LEU C:28 , THR C:29 , GLU C:62 , GLY C:64BINDING SITE FOR RESIDUE ADP B 300
3AC3SOFTWAREGLY A:27 , LEU A:28 , THR A:29 , GLU A:62 , GLY A:64 , ARG A:101 , ARG A:103 , ILE C:7 , GLY C:35 , HIS C:36 , LYS C:58 , GLU C:85 , VAL C:86 , GLY C:87 , ASP C:88 , GLY C:89 , LYS C:90 , HOH C:402 , HOH C:433 , HOH C:435BINDING SITE FOR RESIDUE ADP C 400

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1V9O)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1V9O)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1V9O)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1V9O)

(-) Exons   (0, 0)

(no "Exon" information available for 1V9O)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:97
 aligned with P83820_THETH | P83820 from UniProtKB/TrEMBL  Length:116

    Alignment length:110
                                    10        20        30        40        50        60        70        80        90       100       110
         P83820_THETH     1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDEA 110
               SCOP domains d1v9oa_ A: PII (product of glnB)                                                                               SCOP domains
               CATH domains 1v9oA00 A:1-110  [code=3.30.70.120, no n             ame defined]                                              CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeehhhhhhhhhhhhhhh.....eeeeeeee....-------------..eeeeeeeeeehhhhhhhhhhhhhhhhh.......eeeeee..eeee.....ee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1v9o A   1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGET-------------ELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDEA 110
                                    10        20        30        40         -   |    60        70        80        90       100       110
                                                                  40            54                                                        

Chain B from PDB  Type:PROTEIN  Length:93
 aligned with P83820_THETH | P83820 from UniProtKB/TrEMBL  Length:116

    Alignment length:108
                                    10        20        30        40        50        60        70        80        90       100        
         P83820_THETH     1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108
               SCOP domains d1v9ob_ B: PII (product of glnB)                                                                             SCOP domains
               CATH domains 1v9oB00 B:1-108  [code=3.30.70.120, n               o name defined]                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeehhhhhhhhhhhhhhh....eeeeeeeee.---------------...eeeeeeeeeehhhhhhhhhhhhhhhhh.......eeeeee..eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 1v9o B   1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHG---------------MELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108
                                    10        20        30      |  -         -  |     60        70        80        90       100        
                                                               37              53                                                       

Chain C from PDB  Type:PROTEIN  Length:90
 aligned with P83820_THETH | P83820 from UniProtKB/TrEMBL  Length:116

    Alignment length:108
                                    10        20        30        40        50        60        70        80        90       100        
         P83820_THETH     1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108
               SCOP domains d1v9oc_ C: PII (product of glnB)                                                                             SCOP domains
               CATH domains 1v9oC00 C:1-108  [code=3.30.70.120,                   no name defined]                                       CATH domains
           Pfam domains (1) ---P-II-1v9oC01 C:4-105                                                                                  --- Pfam domains (1)
           Pfam domains (2) ---P-II-1v9oC02 C:4-105                                                                                  --- Pfam domains (2)
           Pfam domains (3) ---P-II-1v9oC03 C:4-105                                                                                  --- Pfam domains (3)
         Sec.struct. author .eeeeeeehhhhhhhhhhhhhhh....eeeeeeee.------------------.eeeeeeeeeehhhhhhhhhhhhhhhhh.......eeeeee..eeee....ee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 1v9o C   1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGH------------------LHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108
                                    10        20        30     |   -         -    |   60        70        80        90       100        
                                                              36                 55                                                     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Family: P-II (26)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (P83820_THETH | P83820)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0030234    enzyme regulator activity    Binds to and modulates the activity of an enzyme.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0050790    regulation of catalytic activity    Any process that modulates the activity of an enzyme.
    GO:0006808    regulation of nitrogen utilization    Any process that modulates the frequency, rate or extent of nitrogen utilization.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ADP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1v9o)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1v9o
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  P83820_THETH | P83820
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  P83820_THETH | P83820
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        P83820_THETH | P838201ufl 1v3r 1v3s 1vfj

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1V9O)