|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
Asymmetric/Biological Unit (1, 3)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1V9O) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1V9O) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1V9O) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1V9O) |
Exons (0, 0)| (no "Exon" information available for 1V9O) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:97 aligned with P83820_THETH | P83820 from UniProtKB/TrEMBL Length:116 Alignment length:110 10 20 30 40 50 60 70 80 90 100 110 P83820_THETH 1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDEA 110 SCOP domains d1v9oa_ A: PII (product of glnB) SCOP domains CATH domains 1v9oA00 A:1-110 [code=3.30.70.120, no n ame defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 1v9o A 1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGET-------------ELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDEA 110 10 20 30 40 - | 60 70 80 90 100 110 40 54 Chain B from PDB Type:PROTEIN Length:93 aligned with P83820_THETH | P83820 from UniProtKB/TrEMBL Length:116 Alignment length:108 10 20 30 40 50 60 70 80 90 100 P83820_THETH 1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108 SCOP domains d1v9ob_ B: PII (product of glnB) SCOP domains CATH domains 1v9oB00 B:1-108 [code=3.30.70.120, n o name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 1v9o B 1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHG---------------MELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108 10 20 30 | - - | 60 70 80 90 100 37 53 Chain C from PDB Type:PROTEIN Length:90 aligned with P83820_THETH | P83820 from UniProtKB/TrEMBL Length:116 Alignment length:108 10 20 30 40 50 60 70 80 90 100 P83820_THETH 1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108 SCOP domains d1v9oc_ C: PII (product of glnB) SCOP domains CATH domains 1v9oC00 C:1-108 [code=3.30.70.120, no name defined] CATH domains Pfam domains (1) ---P-II-1v9oC01 C:4-105 --- Pfam domains (1) Pfam domains (2) ---P-II-1v9oC02 C:4-105 --- Pfam domains (2) Pfam domains (3) ---P-II-1v9oC03 C:4-105 --- Pfam domains (3) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 1v9o C 1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGH------------------LHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108 10 20 30 | - - | 60 70 80 90 100 36 55
|
||||||||||||||||||||
SCOP Domains (1, 3)
Asymmetric/Biological Unit
|
CATH Domains (1, 3)| Asymmetric/Biological Unit |
Pfam Domains (1, 3)
Asymmetric/Biological Unit
|
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B,C (P83820_THETH | P83820)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|