|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)| Asymmetric Unit (2, 5) Biological Unit 1 (1, 4) Biological Unit 2 (1, 2) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
Cis Peptide Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1V98) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1V98) |
Exons (0, 0)| (no "Exon" information available for 1V98) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:92 aligned with Q5SI93_THET8 | Q5SI93 from UniProtKB/TrEMBL Length:140 Alignment length:92 58 68 78 88 98 108 118 128 138 Q5SI93_THET8 49 GAPLTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYLEGR 140 SCOP domains d1v98a_ A: automated matches SCOP domains CATH domains 1v98A00 A:49-140 Glutaredoxin CATH domains Pfam domains -------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------- Transcript 1v98 A 49 GAPLTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYLEGR 140 58 68 78 88 98 108 118 128 138 Chain B from PDB Type:PROTEIN Length:89 aligned with Q5SI93_THET8 | Q5SI93 from UniProtKB/TrEMBL Length:140 Alignment length:89 60 70 80 90 100 110 120 130 Q5SI93_THET8 51 PLTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYLEG 139 SCOP domains d1v98b_ B: automated matches SCOP domains CATH domains 1v98B00 B:51-139 Glutaredoxin CATH domains Pfam domains (1) Thioredoxin-1v98B01 B:51-135 ---- Pfam domains (1) Pfam domains (2) Thioredoxin-1v98B02 B:51-135 ---- Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1v98 B 51 PLTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYLEG 139 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Q5SI93_THET8 | Q5SI93)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|