|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1V8H) |
Sites (0, 0)| (no "Site" information available for 1V8H) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1V8H) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1V8H) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1V8H) |
Exons (0, 0)| (no "Exon" information available for 1V8H) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:106 aligned with Q5SME6_THET8 | Q5SME6 from UniProtKB/TrEMBL Length:108 Alignment length:106 11 21 31 41 51 61 71 81 91 101 Q5SME6_THET8 2 PFRTIARLNPAKPKAGEEFRLQVVAQHPNEPGTRRDAEGKLIPAKYINLVEVYFEGEKVAEARPGPSTSANPLYAFKFKAEKAGTFTIKLKDTDGDTGEASVKLEL 107 SCOP domains d1v8ha1 A:2-107 Sulfur oxidation protein SoxZ SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 1v8h A 2 PFRTIARLNPAKPKAGEEFRLQVVAQHPNEPGTRRDAEGKLIPAKYINLVEVYFEGEKVAEARPGPSTSANPLYAFKFKAEKAGTFTIKLKDTDGDTGEASVKLEL 107 11 21 31 41 51 61 71 81 91 101 Chain B from PDB Type:PROTEIN Length:106 aligned with Q5SME6_THET8 | Q5SME6 from UniProtKB/TrEMBL Length:108 Alignment length:106 11 21 31 41 51 61 71 81 91 101 Q5SME6_THET8 2 PFRTIARLNPAKPKAGEEFRLQVVAQHPNEPGTRRDAEGKLIPAKYINLVEVYFEGEKVAEARPGPSTSANPLYAFKFKAEKAGTFTIKLKDTDGDTGEASVKLEL 107 SCOP domains d1v8hb_ B: Sulfur oxidation protein SoxZ SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) -----SoxZ-1v8hB01 B:7-105 -- Pfam domains (1) Pfam domains (2) -----SoxZ-1v8hB02 B:7-105 -- Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 1v8h B 2 PFRTIARLNPAKPKAGEEFRLQVVAQHPNEPGTRRDAEGKLIPAKYINLVEVYFEGEKVAEARPGPSTSANPLYAFKFKAEKAGTFTIKLKDTDGDTGEASVKLEL 107 11 21 31 41 51 61 71 81 91 101
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1V8H) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1V8H)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|