|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1V5N) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1V5N) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1V5N) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1V5N) |
Exons (0, 0)| (no "Exon" information available for 1V5N) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:89 aligned with NRX1_ARATH | O80763 from UniProtKB/Swiss-Prot Length:578 Alignment length:120 457 467 477 487 497 507 517 527 537 547 557 567 NRX1_ARATH 448 AALGPTGQTVTKEARDLVVAHGADAYPFTEERLKEIEAKYDEIAKDWPKKVKHVLHEEHELELTRVQVYTCDKCEEEGTIWSYHCDECDFDLHAKCALNEDTKENGDEAVKVGGDESKDG 567 SCOP domains d1v5na_ A: Pdi-like hypothetical protein At1g60420 SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains --------------------------------------------------------------------C1_3-1v5nA01 A:48-76 ----------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript 1v5n A 1 GSSGSSG---------------------TEERLKEIEAKYDEIAKDWPKKVKHVLHEEHELELTRVQVYTCDKCEEEGTIWSYHCDECDFDLHAKCALNEDTKESG----------PSSG 89 | - - |9 19 29 39 49 59 69 79 | - | 89 7 8 85 86
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1V5N) |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (9, 9)|
NMR Structure(hide GO term definitions) Chain A (NRX1_ARATH | O80763)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|