|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1UXZ) |
Sites (0, 0)| (no "Site" information available for 1UXZ) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1UXZ) |
Cis Peptide Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1UXZ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1UXZ) |
Exons (0, 0)| (no "Exon" information available for 1UXZ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:131 aligned with O07653_9GAMM | O07653 from UniProtKB/TrEMBL Length:622 Alignment length:131 501 511 521 531 541 551 561 571 581 591 601 611 621 O07653_9GAMM 492 TVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH 622 SCOP domains d1uxza_ A: Cellulase B (lichenase 5a) SCOP domains CATH domains 1uxzA00 A:1-131 Galactose-binding domain-like CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript 1uxz A 1 MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH 131 10 20 30 40 50 60 70 80 90 100 110 120 130 Chain B from PDB Type:PROTEIN Length:131 aligned with O07653_9GAMM | O07653 from UniProtKB/TrEMBL Length:622 Alignment length:131 501 511 521 531 541 551 561 571 581 591 601 611 621 O07653_9GAMM 492 TVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH 622 SCOP domains d1uxzb_ B: Cellulase B (lichenase 5a) SCOP domains CATH domains 1uxzB00 B:1-131 Galactose-binding domain-like CATH domains Pfam domains (1) ------CBM_6-1uxzB01 B:7-129 -- Pfam domains (1) Pfam domains (2) ------CBM_6-1uxzB02 B:7-129 -- Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript 1uxz B 1 MVIATIQAEDHSQQSGTQQETTTDTGGGKNVGYIDAGDWLSYAGTPVNIPSSGSYLIEYRVASQNGGGSLTFEEAGGAPVHGTIAIPATGGWQTWTTIQHTVNLSAGSHQFGIKANAGGWNLNWIRINKTH 131 10 20 30 40 50 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A,B (O07653_9GAMM | O07653)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|