|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1UT3) |
Sites (0, 0)| (no "Site" information available for 1UT3) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1UT3) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1UT3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1UT3) |
Exons (0, 0)| (no "Exon" information available for 1UT3) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:38 aligned with SPHE2_APTPA | P83430 from UniProtKB/Swiss-Prot Length:38 Alignment length:38 10 20 30 SPHE2_APTPA 1 SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVW 38 SCOP domains d1ut3a_ A: Beta-defensin, BD SCOP domains CATH domains -------------------------------------- CATH domains Pfam domains -Defensin_beta-1ut3A01 A:2-35 --- Pfam domains SAPs(SNPs) -------------------------------------- SAPs(SNPs) PROSITE -------------------------------------- PROSITE Transcript -------------------------------------- Transcript 1ut3 A 1 SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVW 38 10 20 30
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1UT3) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (SPHE2_APTPA | P83430)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|