|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1URR) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1URR) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1URR) |
PROSITE Motifs (2, 2)
Asymmetric/Biological Unit (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1URR) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:97 aligned with ACYP2_DROME | Q9VF36 from UniProtKB/Swiss-Prot Length:102 Alignment length:97 15 25 35 45 55 65 75 85 95 ACYP2_DROME 6 VAKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRIPNAKVSKAEFSQIQEIEDYTFTSFDIKH 102 SCOP domains d1urra_ A: Acylphosphatase 2 (Cg18505) SCOP domains CATH domains 1urrA00 A:2-98 [code=3.30.70.100, no name defined] CATH domains Pfam domains Acylphosphatase-1urrA01 A:2-97 - Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ------ACYLPHOSPHATASE_3 PDB: A:8-98 UniProt: 12-102 PROSITE (1) PROSITE (2) -----------ACYLPHOSPHA--------------------------------------------------------------------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------------- Transcript 1urr A 2 VAKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRIPNAKVSKAEFSQIQEIEDYTFTSFDIKH 98 11 21 31 41 51 61 71 81 91
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (ACYP2_DROME | Q9VF36)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|