1UPS - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   GLCNAC[ALPHA]1-4GAL RELEASING ENDO-[BETA]-GALACTOSIDASE FROM CLOSTRIDIUM PERFRINGENS

Authors :   W. Tempel, Z. -J. Liu, P. S. Horanyi, L. Deng, D. Lee, M. G. Newton, J. P. Rose, H. Ashida, S. -C. Li, Y. -T. Li, B. -C. Wang, Southeast Collaboratory For Structural Genomics (Secsg)

Date :   10 Oct 03 (Deposition) - 25 Nov 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.82

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Endo-Galactosidase, Clostridium Perfringens, Glycosyl Hydrolase, Psi, Protein Structure Initiative, Southeast Collaboratory For Structural Genomics, Secsg (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   W. Tempel, Z. -J. Liu, P. S. Horanyi, L. Deng, D. Lee, M. G. Newton, J. P. Rose, H. Ashida, S. -C. Li, Y. -T. Li, B. -C. Wang
Three-Dimensional Structure Of Glcnacalpha1-4Gal Releasing Endo-Beta-Galactosidase From Clostridium Perfringens.
Proteins: Struct. , Funct. , V. 59 141 2005 Genet.
PubMed-ID: 15688452 | Reference-DOI: 10.1002/PROT.20363

Molecule 1 - GLCNAC-ALPHA-1,4-GAL-RELEASING ENDO-BETA- GALACTOSIDASE
	Atcc	:	10543
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Scientific	:	CLOSTRIDIUM PERFRINGENS
	Organism Taxid	:	1502

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	CA	2	Ligand/Ion	CALCIUM ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLU A:37 , ASN A:39 , GLY A:72 , ASP A:272 , HOH A:2015 , HOH A:2126	BINDING SITE FOR RESIDUE CA A 501
2	AC2	SOFTWARE	GLU B:37 , ASN B:39 , GLY B:72 , ASP B:272 , HOH B:2012 , HOH B:2130	BINDING SITE FOR RESIDUE CA B 501

Asymmetric Unit

No.	Residues
1	A:57	-	A:86
2	B:57	-	B:86

Asymmetric Unit

No.	Residues
1	Gly A:40	-	Pro A:41
2	Trp A:265	-	Pro A:266
3	Gly B:40	-	Pro B:41
4	Trp B:265	-	Pro B:266

(no "SAP(SNP)/Variant" information available for 1UPS)

(no "PROSITE Motif" information available for 1UPS)

(no "Exon" information available for 1UPS)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:402
 aligned with Q934G8_CLOPF | Q934G8 from UniProtKB/TrEMBL  Length:420

    Alignment length:404
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416    
         Q934G8_CLOPF    17 AKDFPANPIEKAGYKLDFSDEFNGPTLDREKWTDYYLPHWCKDPESAKANYRFENGSLVEYITEDQKPWCPEHDGTVRSSAIMSFDKSWIHNFSGTTDNHERNEWRGYTTKYGYFEIRAKLSNTGGGGHQAWWMVGMQDDTNDWFNSKQTGEIDILETFFSKKDTWRIAAYGWNDPNFQTSWTISEDKVPSGDPTSEYHIYAMEWTPTALKFYYDNELFKVIYGSPDYEMGTILNIYTDAGSGAHNDVWPKEWAIDYMRVWKPVDGYKESESLNNYLIRNRQTGKFLYIEENNDKVSYGDITLKNEKNAKWSKEYRDGYTLLKNNETGEYLNIENQTGYIEHGKVPKTWWSAQWSEVPVDGYTRFVNRWKPNMSIHTESYEGVLQYGNVPNTYWTSQWQLIPVE 420
               SCOP domains --d1upsa1 A:19-284 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, catalytic domain                                                                                                                                                                           -----d1upsa2 A:290-420 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain                                   SCOP domains
               CATH domains 1upsA01 A:17-285  [code=2.60.120.200, no name defined]                                                                                                                                                                                                                       1  upsA02 A:286-420  [code=2.80.10.50, no name defined]                                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............eeeeeee................hhhhh.hhhhh..eeeee..eeeeee.......hhhhhh..eeeeee.ee..................ee......eeeeeeee........eeeeeeee...............eeeee........eeeeeee...........eeeeee..........eeeeeee...eeeeee..eeeeeee......eeeeeeeee............eeeeeeeeeeeee.......--..eeeeee.....eee........eee......hhhh.eeeeee..eeeeee.....eee........eee.....hhhh.eeeeee..eeeeee......eee........eee.....hhhh.eeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ups A  17 AKDFPANPIEKAGYKLDFSDEFNGPTLDREKWTDYYLPHWCKDPESAKANYRFENGSLVEYITEDQKPWCPEHDGTVRSSAIMSFDKSWIHNFSGTTDNHERNEWRGYTTKYGYFEIRAKLSNTGGGGHQAWWMVGMQDDTNDWFNSKQTGEIDILETFFSKKDTWRIAAYGWNDPNFQTSWTISEDKVPSGDPTSEYHIYAMEWTPTALKFYYDNELFKVIYGSPDYEMGTILNIYTDAGSGAHNDVWPKEWAIDYMRVWKPVDGYKES--LNNYLIRNRQTGKFLYIEENNDKVSYGDITLKNEKNAKWSKEYRDGYTLLKNNETGEYLNIENQTGYIEHGKVPKTWWSAQWSEVPVDGYTRFVNRWKPNMSIHTESYEGVLQYGNVPNTYWTSQWQLIPVE 420
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286  |    296       306       316       326       336       346       356       366       376       386       396       406       416    
                                                                                                                                                                                                                                                                                                       286  |                                                                                                                                   
                                                                                                                                                                                                                                                                                                          289

Chain B from PDB  Type:PROTEIN  Length:397
 aligned with Q934G8_CLOPF | Q934G8 from UniProtKB/TrEMBL  Length:420

    Alignment length:402
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418  
         Q934G8_CLOPF    19 DFPANPIEKAGYKLDFSDEFNGPTLDREKWTDYYLPHWCKDPESAKANYRFENGSLVEYITEDQKPWCPEHDGTVRSSAIMSFDKSWIHNFSGTTDNHERNEWRGYTTKYGYFEIRAKLSNTGGGGHQAWWMVGMQDDTNDWFNSKQTGEIDILETFFSKKDTWRIAAYGWNDPNFQTSWTISEDKVPSGDPTSEYHIYAMEWTPTALKFYYDNELFKVIYGSPDYEMGTILNIYTDAGSGAHNDVWPKEWAIDYMRVWKPVDGYKESESLNNYLIRNRQTGKFLYIEENNDKVSYGDITLKNEKNAKWSKEYRDGYTLLKNNETGEYLNIENQTGYIEHGKVPKTWWSAQWSEVPVDGYTRFVNRWKPNMSIHTESYEGVLQYGNVPNTYWTSQWQLIPVE 420
               SCOP domains d1upsb1 B:19-284 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, catalytic domain                                                                                                                                                                           -----d1upsb2 B:290-420 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain                                   SCOP domains
               CATH domains 1upsB01 B:19-283  [code=2.60.120.200, no name defined]                                                                                                                                                                                                                   1     upsB02 B:284-420  [code=2.80.10.50, no name defined]                                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........eeeeeee................hhhhh.hhhhh...eeee..eeeeee.......hhhhhh..eeeeee.ee..................ee......eeeeeeee........eeeeeeee...............eeeee........eeeeeee...........eeeeee..........eeeeeee...eeeeee..eeeeeee......eeeeeeeee............eeeeeeeeeeeee.....-----..eeeee.....eee........eee......hhhh.eeeeee..eeeeee.....eee........eee.....hhhh.eeeeee..eeeeee......eee........eee.....hhhh.eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1ups B  19 DFPANPIEKAGYKLDFSDEFNGPTLDREKWTDYYLPHWCKDPESAKANYRFENGSLVEYITEDQKPWCPEHDGTVRSSAIMSFDKSWIHNFSGTTDNHERNEWRGYTTKYGYFEIRAKLSNTGGGGHQAWWMVGMQDDTNDWFNSKQTGEIDILETFFSKKDTWRIAAYGWNDPNFQTSWTISEDKVPSGDPTSEYHIYAMEWTPTALKFYYDNELFKVIYGSPDYEMGTILNIYTDAGSGAHNDVWPKEWAIDYMRVWKPVDGYK-----NNYLIRNRQTGKFLYIEENNDKVSYGDITLKNEKNAKWSKEYRDGYTLLKNNETGEYLNIENQTGYIEHGKVPKTWWSAQWSEVPVDGYTRFVNRWKPNMSIHTESYEGVLQYGNVPNTYWTSQWQLIPVE 420
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278     |   - |     298       308       318       328       338       348       358       368       378       388       398       408       418  
                                                                                                                                                                                                                                                                                                   284   290

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Jelly Rolls (1293)

Homologous Superfamily: [code=2.60.120.200, no name defined] (421)

Clostridium perfringens. Organism_taxid: 1502. (1)

1a	1upsB01	B:19-283
1b	1upsA01	A:17-285

Architecture: Trefoil (289)

Topology: Trefoil (Acidic Fibroblast Growth Factor, subunit A) (289)

Homologous Superfamily: [code=2.80.10.50, no name defined] (289)

Clostridium perfringens. Organism_taxid: 1502. (1)

2a	1upsA02	A:286-420
2b	1upsB02	B:284-420

(no "Pfam Domain" information available for 1UPS)

Asymmetric Unit(hide GO term definitions)

Chain A,B (Q934G8_CLOPF | Q934G8)

molecular function
	GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds	Catalysis of the hydrolysis of any O-glycosyl bond.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:40 - Pro A:41	[ RasMol ]
		Gly B:40 - Pro B:41	[ RasMol ]
		Trp A:265 - Pro A:266	[ RasMol ]
		Trp B:265 - Pro B:266	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ups
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q934G8_CLOPF \| Q934G8
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q934G8_CLOPF \| Q934G8
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1UPS)

(no "Related Entries Specified in the PDB File" available for 1UPS)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (2, 2)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (3, 3)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File