|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 5)
Asymmetric/Biological Unit (1, 5)
|
Sites (0, 0)| (no "Site" information available for 1UPG) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1UPG) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1UPG) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1UPG) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1UPG) |
Exons (0, 0)| (no "Exon" information available for 1UPG) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:91 aligned with TRAM_RHIRD | Q57471 from UniProtKB/Swiss-Prot Length:102 Alignment length:91 21 31 41 51 61 71 81 91 101 TRAM_RHIRD 12 VELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLYSILGFIPKVVVN 102 SCOP domains d1upga_ A: Transcriptional repressor TraM SCOP domains CATH domains ------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------- Transcript 1upg A 12 VELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEmHAQmSALNTLYSILGFIPKVVVN 102 21 31 41 51 61 71 |81 | 91 101 79-MSE 83-MSE Chain B from PDB Type:PROTEIN Length:100 aligned with TRAM_RHIRD | Q57471 from UniProtKB/Swiss-Prot Length:102 Alignment length:100 10 20 30 40 50 60 70 80 90 100 TRAM_RHIRD 1 MELEDANVTKKVELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLYSILGFIPKVV 100 SCOP domains d1upgb_ B: Transcriptional repressor TraM SCOP domains CATH domains ---------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) Prok-TraM-1upgB01 B:1-99 - Pfam domains (1) Pfam domains (2) Prok-TraM-1upgB02 B:1-99 - Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------- Transcript 1upg B 1 mELEDANVTKKVELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEmHAQmSALNTLYSILGFIPKVV 100 | 10 20 30 40 50 60 70 80 | 90 100 1-MSE 79-MSE 83-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1UPG) |
Pfam Domains (1, 2)| Asymmetric/Biological Unit |
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (TRAM_RHIRD | Q57471)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|