Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE HUMAN ADVILLIN C-TERMINAL HEADPIECE SUBDOMAIN
 
Authors :  W. Vermeulen, M. Van Troys, P. Vanhaesebrouck, M. Verschueren, F. Fant, C. Ampe, J. Martins, F. Borremans
Date :  09 Sep 03  (Deposition) - 15 Jul 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (25x)
Keywords :  Actin Binding, F-Actin Binding, Cytoskeleton, Headpiece Subdomain (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  W. Vermeulen, P. Vanhaesebrouck, M. Van Troys, M. Verschueren, F. Fant, M. Goethals, C. Ampe, J. Martins, F. Borremans
Solution Structures Of The C-Terminal Headpiece Subdomains Of Human Villin And Advillin, Evaluation Of Headpiece F-Actin-Binding Requirements
Protein Sci. V. 13 1276 2004
PubMed-ID: 15096633  |  Reference-DOI: 10.1110/PS.03518104

(-) Compounds

Molecule 1 - ADVILLIN
    Cell: PERIPHERAL NEURON
    Chains: A
    Fragment: HEADPIECE C-TERMINAL SUBDOMAIN, RESIDUES 784-819
    Organ: BRAIN
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: P92
    Synthetic: YES

 Structural Features

(-) Chains, Units

  
NMR Structure (25x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

NMR Structure (1, 1)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP

(-) Sites  (0, 0)

(no "Site" information available for 1UND)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UND)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UND)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1UND)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1UND)

(-) Exons   (1, 1)

NMR Structure (1, 1)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002578611ENSE00000920412chr12:58209852-5820975895AVIL_HUMAN1-22220--
1.2ENST000002578612ENSE00000920413chr12:58208009-5820793575AVIL_HUMAN23-47250--
1.3ENST000002578613ENSE00000920414chr12:58207206-58207010197AVIL_HUMAN48-113660--
1.4ENST000002578614ENSE00000920415chr12:58204910-58204802109AVIL_HUMAN113-149370--
1.5ENST000002578615ENSE00001622264chr12:58204709-58204599111AVIL_HUMAN150-186370--
1.6ENST000002578616ENSE00000920417chr12:58204334-58204132203AVIL_HUMAN187-254680--
1.7ENST000002578617ENSE00000920418chr12:58203673-5820359579AVIL_HUMAN254-280270--
1.8ENST000002578618ENSE00000920419chr12:58203478-5820338099AVIL_HUMAN281-313330--
1.9ENST000002578619ENSE00000920420chr12:58202331-58202178154AVIL_HUMAN314-365520--
1.10ENST0000025786110ENSE00001353899chr12:58202077-58201977101AVIL_HUMAN365-398340--
1.11ENST0000025786111ENSE00000920422chr12:58201510-58201373138AVIL_HUMAN399-444460--
1.12ENST0000025786112ENSE00000920423chr12:58201272-58201114159AVIL_HUMAN445-497530--
1.13ENST0000025786113ENSE00001353892chr12:58200322-58200143180AVIL_HUMAN498-557600--
1.14ENST0000025786114ENSE00000920425chr12:58197452-58197307146AVIL_HUMAN558-606490--
1.15ENST0000025786115ENSE00000920426chr12:58197174-58197030145AVIL_HUMAN606-654490--
1.16ENST0000025786116ENSE00000920427chr12:58196131-58195943189AVIL_HUMAN655-717630--
1.17ENST0000025786117ENSE00000920428chr12:58194995-5819492769AVIL_HUMAN718-740230--
1.18ENST0000025786118ENSE00000920429chr12:58193703-58193578126AVIL_HUMAN741-782420--
1.19ENST0000025786119ENSE00000920430chr12:58191778-58191437342AVIL_HUMAN783-819371A:0-3637

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:37
 aligned with AVIL_HUMAN | O75366 from UniProtKB/Swiss-Prot  Length:819

    Alignment length:37
                                   792       802       812       
           AVIL_HUMAN   783 NYLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF 819
               SCOP domains d1unda_ A: Advillin                   SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains -VHP-1undA01 A:1-36                   Pfam domains
         Sec.struct. author ...hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
               Transcript 1 Exon 1.19  PDB: A:0-36                Transcript 1
                 1und A   0 xYLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF  36
                            |        9        19        29       
                            |                                    
                            0-ACE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1UND)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: VHP] (23)

(-) Gene Ontology  (13, 13)

NMR Structure(hide GO term definitions)
Chain A   (AVIL_HUMAN | O75366)
molecular function
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
biological process
    GO:0051693    actin filament capping    The binding of a protein or protein complex to the end of an actin filament, thus preventing the addition, exchange or removal of further actin subunits.
    GO:0060271    cilium assembly    The assembly of a cilium, a specialized eukaryotic organelle that consists of a filiform extrusion of the cell surface. Each cilium is bounded by an extrusion of the cytoplasmic membrane, and contains a regular longitudinal array of microtubules, anchored basally in a centriole.
    GO:0007010    cytoskeleton organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures.
    GO:0007399    nervous system development    The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
    GO:0010976    positive regulation of neuron projection development    Any process that increases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
    GO:0010975    regulation of neuron projection development    Any process that modulates the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
cellular component
    GO:0015629    actin cytoskeleton    The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
    GO:0030424    axon    The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
    GO:0042995    cell projection    A prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1und)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1und)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1und
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AVIL_HUMAN | O75366
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  AVIL_HUMAN | O75366
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1UND)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UND)