Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF S8-SP11
 
Authors :  M. Mishima, S. Takayama, K. Sasaki, J. G. Jee, C. Kojima, A. Isogai, M. Shirakawa, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  16 Jun 03  (Deposition) - 30 Sep 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (30x)
Keywords :  Nmr, Male Determinant Of Self-Incompatibility, Defensin- Like, Sp11, Scr, Cysteine-Rich, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Plant Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Mishima, S. Takayama, K. Sasaki, J. G. Jee, C. Kojima, A. Isogai, M. Shirakawa
Structure Of The Male Determinant Factor For Brassica Self-Incompatibility
J. Biol. Chem. V. 278 36389 2003
PubMed-ID: 12835321  |  Reference-DOI: 10.1074/JBC.M305305200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - S-LOCUS POLLEN PROTEIN
    ChainsA
    EngineeredYES
    FragmentRESIDUES 1-50
    Other DetailsTHIS SEQUENCE OCCURS NATURALLY IN BRASSICA RAPA
    SynonymSP8-SP11
    SyntheticYES

 Structural Features

(-) Chains, Units

  
NMR Structure (30x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1UGL)

(-) Sites  (0, 0)

(no "Site" information available for 1UGL)

(-) SS Bonds  (4, 4)

NMR Structure
No.Residues
1A:6 -A:50
2A:16 -A:35
3A:24 -A:45
4A:33 -A:47

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UGL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1UGL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1UGL)

(-) Exons   (0, 0)

(no "Exon" information available for 1UGL)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:50
 aligned with Q9SE17_BRACM | Q9SE17 from UniProtKB/TrEMBL  Length:74

    Alignment length:50
                                    34        44        54        64        74
          Q9SE17_BRACM   25 NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTHSCDCKSC 74
               SCOP domains d1ugla_ A: S-locus pollen protein                  SCOP domains
               CATH domains 1uglA00 A:1-50 Scorpion toxin-like                 CATH domains
               Pfam domains SCRL-1uglA01 A:1-49                              - Pfam domains
         Sec.struct. author ...........ee...hhhhhhhhhhhh.............ee....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------- Transcript
                  1ugl A  1 NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTHSCDCKSC 50
                                    10        20        30        40        50

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (Q9SE17_BRACM | Q9SE17)
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ugl)
 
  Sites
(no "Sites" information available for 1ugl)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ugl)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ugl
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9SE17_BRACM | Q9SE17
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9SE17_BRACM | Q9SE17
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1UGL)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UGL)