Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF TT1020 FROM THERMUS THERMOPHILUS HB8
 
Authors :  H. Wang, H. Sakai, C. Hori-Takemoto, T. Kaminishi, T. Terada, S. Kurami M. Shirouzu, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  31 May 03  (Deposition) - 30 Nov 03  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  A,B,C  (2x)
Keywords :  Structural Genomics, Signal Transducing Protein, Riken Structural Genomics/Proteomics Initiative, Rsgi, Nppsfa, National Project On Protein Structural And Functional Analyses, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Sakai, H. Wang, C. Takemoto-Hori, T. Kaminishi, H. Yamaguchi, Y. Kamewari, T. Terada, S. Kuramitsu, M. Shirouzu, S. Yokoyama
Crystal Structures Of The Signal Transducing Protein Glnk From Thermus Thermophilus Hb8.
J. Struct. Biol. V. 149 99 2005
PubMed-ID: 15629661  |  Reference-DOI: 10.1016/J.JSB.2004.08.007

(-) Compounds

Molecule 1 - NITROGEN REGULATORY PROTEIN P-II
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET26B
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Mutation: YES
    Organism Scientific: THERMUS THERMOPHILUS
    Organism Taxid: 300852
    Strain: HB8

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit : ABC
Biological Unit 1 (1x): ABC
Biological Unit 2 (2x): ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1UFL)

(-) Sites  (0, 0)

(no "Site" information available for 1UFL)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UFL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1UFL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1UFL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1UFL)

(-) Exons   (0, 0)

(no "Exon" information available for 1UFL)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:108
 aligned with P83820_THETH | P83820 from UniProtKB/TrEMBL  Length:116

    Alignment length:108
                                    10        20        30        40        50        60        70        80        90       100        
         P83820_THETH     1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108
               SCOP domains d1ufla_ A: PII (product of glnB)                                                                             SCOP domains
               CATH domains 1uflA00 A:1-108  [code=3.30.70.120, no name defined]                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeee...hhhhhhhhhhhh.....eeeeeee....................eeeeeeeeeehhhhhhhhhhhhhhhhh.......eeeeee..eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 1ufl A   1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEED 108
                                    10        20        30        40        50        60        70        80        90       100        


Chain B from PDB  Type:PROTEIN  Length:96
 aligned with P83820_THETH | P83820 from UniProtKB/TrEMBL  Length:116

    Alignment length:113
                                    10        20        30        40        50        60        70        80        90       100       110   
         P83820_THETH     1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDEAAVT 113
               SCOP domains d1uflb_ B: PII (product of glnB)                                                                                  SCOP domains
               CATH domains 1uflB00 B:1-113  [code=3.30.70.120,                  no name defined]                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeehhhhhhhhhhhhhhh.....eeeeeeee-----------------..eeeeeeeeeehhhhhhhhhhhhhhhhh.......eeeeee....ee.....hhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------- Transcript
                 1ufl B   1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGH-----------------ELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDEAAVT 113
                                    10        20        30     |   -         -   |    60        70        80        90       100       110   
                                                              36                54                                                           


Chain C from PDB  Type:PROTEIN  Length:99
 aligned with P83820_THETH | P83820 from UniProtKB/TrEMBL  Length:116

    Alignment length:109
                                    10        20        30        40        50        60        70        80        90       100         
         P83820_THETH     1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDE 109
               SCOP domains d1uflc_ C: PII (product of glnB)                                                                              SCOP domains
               CATH domains 1uflC00 C:1-109  [code=3.30.70.120, n          o name defined]                                                CATH domains
           Pfam domains (1) ---P-II-1uflC01 C:4-105                                                                                  ---- Pfam domains (1)
           Pfam domains (2) ---P-II-1uflC02 C:4-105                                                                                  ---- Pfam domains (2)
           Pfam domains (3) ---P-II-1uflC03 C:4-105                                                                                  ---- Pfam domains (3)
         Sec.struct. author .eeeeeee...hhhhhhhhhhh.....eeeeeeee..----------..eeee..eeeeee..ee...hhhhhhhhhhhhhh......eeeeeee..eee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------- Transcript
                 1ufl C   1 MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHG----------GTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDE 109
                                    10        20        30      |  -       |50        60        70        80        90       100         
                                                               37         48
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 3)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 3)

Asymmetric Unit
(-)
Clan: GlnB-like (50)
(-)
Family: P-II (26)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (P83820_THETH | P83820)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0030234    enzyme regulator activity    Binds to and modulates the activity of an enzyme.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0050790    regulation of catalytic activity    Any process that modulates the activity of an enzyme.
    GO:0006808    regulation of nitrogen utilization    Any process that modulates the frequency, rate or extent of nitrogen utilization.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ufl)
 
  Sites
(no "Sites" information available for 1ufl)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ufl)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ufl
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  P83820_THETH | P83820
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  P83820_THETH | P83820
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        P83820_THETH | P83820: 1v3r 1v3s 1v9o 1vfj

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UFL)