Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  TRYPTOPHAN SYNTHASE (E.C.4.2.1.20) WITH A MUTATION OF LYS 87->THR IN THE B SUBUNIT AND IN THE PRESENCE OF LIGAND L-SERINE
 
Authors :  S. Rhee, K. Parris, S. A. Ahmed, E. W. Miles, D. R. Davies
Date :  14 Dec 95  (Deposition) - 08 Mar 96  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Lyase-Peptide Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Rhee, K. D. Parris, C. C. Hyde, S. A. Ahmed, E. W. Miles, D. R. Davies
Crystal Structures Of A Mutant (Betak87T) Tryptophan Synthase Alpha2Beta2 Complex With Ligands Bound To The Active Sites Of The Alpha- And Beta-Subunits Reveal Ligand-Induced Conformational Changes.
Biochemistry V. 36 7664 1997
PubMed-ID: 9201907  |  Reference-DOI: 10.1021/BI9700429
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRYPTOPHAN SYNTHASE
    ChainsA
    EC Number4.2.1.20
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System GeneTRPA/TRPB
    Expression System PlasmidPSTB7
    Expression System StrainCB149
    Expression System Taxid562
    GeneTRPA/TRPB
    MutationYES
    Organism ScientificSALMONELLA TYPHIMURIUM
    Organism Taxid602
 
Molecule 2 - TRYPTOPHAN SYNTHASE
    ChainsB
    EC Number4.2.1.20
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System GeneTRPA/TRPB
    Expression System PlasmidPSTB7
    Expression System StrainCB149
    Expression System Taxid562
    GeneTRPA/TRPB
    MutationYES
    Organism ScientificSALMONELLA TYPHIMURIUM
    Organism Taxid602

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric Unit (3, 3)
No.NameCountTypeFull Name
1NA1Ligand/IonSODIUM ION
2PLP1Ligand/IonPYRIDOXAL-5'-PHOSPHATE
3SER1Mod. Amino AcidSERINE
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1NA-1Ligand/IonSODIUM ION
2PLP2Ligand/IonPYRIDOXAL-5'-PHOSPHATE
3SER2Mod. Amino AcidSERINE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY B:232 , PHE B:306 , SER B:308 , HOH B:412 , HOH B:432BINDING SITE FOR RESIDUE NA B 400
2AC2SOFTWARETHR B:110 , GLY B:111 , ALA B:112 , GLY B:113 , GLN B:114 , HIS B:115 , GLY B:303 , ASP B:305 , PLP B:401 , HOH B:448BINDING SITE FOR RESIDUE SER B 398
3AC3SOFTWAREHIS B:86 , GLN B:114 , THR B:190 , GLY B:232 , GLY B:233 , GLY B:234 , SER B:235 , ASN B:236 , GLY B:303 , GLU B:350 , SER B:377 , SER B:398 , HOH B:425 , HOH B:452BINDING SITE FOR RESIDUE PLP B 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1UBS)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric Unit
No.Residues
1Asp A:27 -Pro A:28
2Arg B:55 -Pro B:56
3His B:195 -Pro B:196

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1UBS)

(-) PROSITE Motifs  (2, 2)

Asymmetric Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRP_SYNTHASE_ALPHAPS00167 Tryptophan synthase alpha chain signature.TRPA_SALTY48-61  1A:48-61
2TRP_SYNTHASE_BETAPS00168 Tryptophan synthase beta chain pyridoxal-phosphate attachment site.TRPB_SALTI80-94  1B:80-94
TRPB_SALTY80-94  1B:80-94
Biological Unit 1 (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRP_SYNTHASE_ALPHAPS00167 Tryptophan synthase alpha chain signature.TRPA_SALTY48-61  2A:48-61
2TRP_SYNTHASE_BETAPS00168 Tryptophan synthase beta chain pyridoxal-phosphate attachment site.TRPB_SALTI80-94  2B:80-94
TRPB_SALTY80-94  2B:80-94

(-) Exons   (0, 0)

(no "Exon" information available for 1UBS)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:257
 aligned with TRPA_SALTY | P00929 from UniProtKB/Swiss-Prot  Length:268

    Alignment length:268
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260        
           TRPA_SALTY     1 MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA 268
               SCOP domains d1ubsa_ A: Trp synthase alpha-subunit                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1ubsA00 A:1-268 Aldolase class I                                                                                                                                                                                                                                             CATH domains
               Pfam domains -------Trp_syntA-1ubsA01 A:8-267                                                                                                                                                                                                                                           - Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh...eeeeeee.....hhhhhhhhhhhhh....eeeee..........hhhhhhhhhhh.....hhhhhhhhhhhhhh....eeeeee.hhhhh...hhhhhhhhhhh...eeee....hhh.hhhhhhhhh...eeeeee.....hhhhhhhhhh....eee....-----------.hhhhhhhhhhh....eee......hhhhhhhhhh...eeee..hhhhhhhhh...hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------TRP_SYNTHASE_A--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ubs A   1 MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRS-----------PLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA 268
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180         - |     200       210       220       230       240       250       260        
                                                                                                                                                                                                             180         192                                                                            

Chain B from PDB  Type:PROTEIN  Length:390
 aligned with TRPB_SALTI | P0A2K2 from UniProtKB/Swiss-Prot  Length:397

    Alignment length:394
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392    
           TRPB_SALTI     3 TLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKNYAGRPTALTKCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGMFADFINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQLLVVNLSGRGDKDIFTVHDILKARGE 396
               SCOP domains d1ubsb_ B: Tryptophan synthase, beta-subunit                                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains ------1ubsB01 B:9-53,B:87-205                      1ubsB02 B:54-86,B:206-391        1ubsB01 B:9-53,B:87-205  [code=3.40.50.1100, no name defined]                                                          1ubsB02 B:54-86,B:206-391  [code=3.40.50.1100, no name defined]                                                                                                                           ----- CATH domains
               Pfam domains -----------------------------------------------PALP-1ubsB01 B:50-378                                                                                                                                                                                                                                                                                                                    ------------------ Pfam domains
         Sec.struct. author ................hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.......eee.........eeeeeeehhh.....hhhhhhhhhhhhhhh....eeeeee...hhhhhhhhhhhhh..eeeeeeehhhhh..hhhhhhhhh...eeeee......hhhhhhhhhhhhhhh...eeee.........hhhhhhh...hhhhhhhhhhhhhh.....eeeee....hhhhhhhhhh......eeeeeeeee..hhh.....hhhh.eeeee..eeeee........................hhhhhhhh....eeeeeehhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh.....eeeeeee....hhhhhhhh...----. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----------------------------------------------------------------------------TRP_SYNTHASE_BE-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ubs B   3 TLLNPYFGEFGGMYVPQILMPALNQLEEAFVRAQKDPEFQAQFADLLKNYAGRPTALTKCQNITAGTRTTLYLKREDLLHGGAHTTNQVLGQALLAKRMGKSEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGMFADFINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQLLVVNLSGRGDKDIFTVHDIL----S 398
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382        |-   |
                                                                                                                                                                                                                                                                                                                                                                                                                              391  398

Chain B from PDB  Type:PROTEIN  Length:390
 aligned with TRPB_SALTY | P0A2K1 from UniProtKB/Swiss-Prot  Length:397

    Alignment length:394
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392    
           TRPB_SALTY     3 TLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKNYAGRPTALTKCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGMFADFINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQLLVVNLSGRGDKDIFTVHDILKARGE 396
               SCOP domains d1ubsb_ B: Tryptophan synthase, beta-subunit                                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains ------1ubsB01 B:9-53,B:87-205                      1ubsB02 B:54-86,B:206-391        1ubsB01 B:9-53,B:87-205  [code=3.40.50.1100, no name defined]                                                          1ubsB02 B:54-86,B:206-391  [code=3.40.50.1100, no name defined]                                                                                                                           ----- CATH domains
               Pfam domains -----------------------------------------------PALP-1ubsB01 B:50-378                                                                                                                                                                                                                                                                                                                    ------------------ Pfam domains
         Sec.struct. author ................hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.......eee.........eeeeeeehhh.....hhhhhhhhhhhhhhh....eeeeee...hhhhhhhhhhhhh..eeeeeeehhhhh..hhhhhhhhh...eeeee......hhhhhhhhhhhhhhh...eeee.........hhhhhhh...hhhhhhhhhhhhhh.....eeeee....hhhhhhhhhh......eeeeeeeee..hhh.....hhhh.eeeee..eeeee........................hhhhhhhh....eeeeeehhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh.....eeeeeee....hhhhhhhh...----. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------TRP_SYNTHASE_BE-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ubs B   3 TLLNPYFGEFGGMYVPQILMPALNQLEEAFVRAQKDPEFQAQFADLLKNYAGRPTALTKCQNITAGTRTTLYLKREDLLHGGAHTTNQVLGQALLAKRMGKSEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGMFADFINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQLLVVNLSGRGDKDIFTVHDIL----S 398
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382        |-   |
                                                                                                                                                                                                                                                                                                                                                                                                                              391  398

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit

(-) CATH Domains  (2, 3)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 2)

Asymmetric Unit

(-) Gene Ontology  (12, 27)

Asymmetric Unit(hide GO term definitions)
Chain A   (TRPA_SALTY | P00929)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030170    pyridoxal phosphate binding    Interacting selectively and non-covalently with pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
    GO:0004834    tryptophan synthase activity    Catalysis of the reaction: L-serine + (1S,2R)-1-C-(indol-3-yl)glycerol 3-phosphate = L-tryptophan + glyceraldehyde 3-phosphate + H2O.
biological process
    GO:0009073    aromatic amino acid family biosynthetic process    The chemical reactions and pathways resulting in the formation of aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan).
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0000162    tryptophan biosynthetic process    The chemical reactions and pathways resulting in the formation of tryptophan, the chiral amino acid 2-amino-3-(1H-indol-3-yl)propanoic acid; tryptophan is synthesized from chorismate via anthranilate.
    GO:0006568    tryptophan metabolic process    The chemical reactions and pathways involving tryptophan, the chiral amino acid 2-amino-3-(1H-indol-3-yl)propanoic acid.
cellular component
    GO:0009507    chloroplast    A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain B   (TRPB_SALTY | P0A2K1)
molecular function
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030170    pyridoxal phosphate binding    Interacting selectively and non-covalently with pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
    GO:0004834    tryptophan synthase activity    Catalysis of the reaction: L-serine + (1S,2R)-1-C-(indol-3-yl)glycerol 3-phosphate = L-tryptophan + glyceraldehyde 3-phosphate + H2O.
biological process
    GO:0009073    aromatic amino acid family biosynthetic process    The chemical reactions and pathways resulting in the formation of aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan).
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0000162    tryptophan biosynthetic process    The chemical reactions and pathways resulting in the formation of tryptophan, the chiral amino acid 2-amino-3-(1H-indol-3-yl)propanoic acid; tryptophan is synthesized from chorismate via anthranilate.
    GO:0006568    tryptophan metabolic process    The chemical reactions and pathways involving tryptophan, the chiral amino acid 2-amino-3-(1H-indol-3-yl)propanoic acid.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain B   (TRPB_SALTI | P0A2K2)
molecular function
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0004834    tryptophan synthase activity    Catalysis of the reaction: L-serine + (1S,2R)-1-C-(indol-3-yl)glycerol 3-phosphate = L-tryptophan + glyceraldehyde 3-phosphate + H2O.
biological process
    GO:0009073    aromatic amino acid family biosynthetic process    The chemical reactions and pathways resulting in the formation of aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan).
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0000162    tryptophan biosynthetic process    The chemical reactions and pathways resulting in the formation of tryptophan, the chiral amino acid 2-amino-3-(1H-indol-3-yl)propanoic acid; tryptophan is synthesized from chorismate via anthranilate.
    GO:0006568    tryptophan metabolic process    The chemical reactions and pathways involving tryptophan, the chiral amino acid 2-amino-3-(1H-indol-3-yl)propanoic acid.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PLP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SER  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg B:55 - Pro B:56   [ RasMol ]  
    Asp A:27 - Pro A:28   [ RasMol ]  
    His B:195 - Pro B:196   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ubs
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TRPA_SALTY | P00929
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TRPB_SALTI | P0A2K2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TRPB_SALTY | P0A2K1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.20
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TRPA_SALTY | P00929
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TRPB_SALTI | P0A2K2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TRPB_SALTY | P0A2K1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TRPA_SALTY | P009291a50 1a5a 1a5b 1a5s 1beu 1bks 1c29 1c8v 1c9d 1cw2 1cx9 1fuy 1k3u 1k7e 1k7f 1k7x 1k8x 1k8y 1k8z 1kfb 1kfc 1kfe 1kfj 1kfk 1qop 1qoq 1tjp 1ttp 1ttq 1wbj 2cle 2clf 2clh 2cli 2clk 2cll 2clm 2clo 2j9x 2j9y 2j9z 2rh9 2rhg 2trs 2tsy 2tys 2wsy 3cep 3pr2 4hn4 4hpj 4hpx 4ht3 4kkx 4wx2 4xug 4y6g 4zqc 5bw6 5cgq
        TRPB_SALTI | P0A2K21a5s 1qop 1tjp 1ttp 1ttq 1wbj
        TRPB_SALTY | P0A2K11a50 1a5a 1a5b 1a5s 1beu 1bks 1c29 1c8v 1c9d 1cw2 1cx9 1fuy 1k3u 1k7e 1k7f 1k7x 1k8x 1k8y 1k8z 1kfb 1kfc 1kfe 1kfj 1kfk 1qop 1qoq 1tjp 1ttp 1ttq 1wbj 2cle 2clf 2clh 2cli 2clk 2cll 2clm 2clo 2j9x 2j9y 2j9z 2rh9 2rhg 2trs 2tsy 2tys 2wsy 3cep 3pr2 4hn4 4hpj 4hpx 4ht3 4kkx 4wx2 4xug 4y6g 4zqc 5bw6 5cgq

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1UBS)