|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 4)| Asymmetric/Biological Unit (4, 4) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1U3G) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1U3G) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1U3G) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1U3G) |
Exons (0, 0)| (no "Exon" information available for 1U3G) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:164 aligned with MTHFS_MYCPN | P75430 from UniProtKB/Swiss-Prot Length:164 Alignment length:164 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 MTHFS_MYCPN 1 MDKNALRKQILQKRMALSTIEKSHLDQKINQKLVAFLTPKPCIKTIALYEPIKNEVTFVDFFFEFLKINQIRAVYPKVISDTEIIFIDQETNTFEPNQIDCFLIPLVGFNKDNYRLGFGKGYYDRYLMQLTRQQPKIGIAYSFQKGDFLADPWDVQLDLIINDE 164 SCOP domains d1u3ga_ A: 5,10-methenyltetrahydrofolate synthetase homolog MPN348 SCOP domains CATH domains 1u3gA00 A:1-164 NagB/RpiA/CoA transferase-like CATH domains Pfam domains --5-FTHF_cyc-lig-1u3gA01 A:3-163 - Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1u3g A 1 MDKNALRKQILQKRMALSTIEKSHLDQKINQKLVAFLTPKPCIKTIALYEPIKNEVTFVDFFFEFLKINQIRAVYPKVISDTEIIFIDQETNTFEPNQIDCFLIPLVGFNKDNYRLGFGKGYYDRYLMQLTRQQPKIGIAYSFQKGDFLADPWDVQLDLIINDE 164 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (MTHFS_MYCPN | P75430)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|