1U1I - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   MYO-INOSITOL PHOSPHATE SYNTHASE MIPS FROM A. FULGIDUS

Authors :   K. A. Stieglitz, H. Yang, M. F. Roberts, B. Stec

Date :   15 Jul 04 (Deposition) - 10 Aug 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Nad Cofactor, Metal Ions, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. A. Stieglitz, H. Yang, M. F. Roberts, B. Stec
Reaching For Mechanistic Consensus Across Life Kingdoms: Structure And Insights Into Catalysis Of The Myo-Inositol-1-Phosphate Synthase (Mips) From Archaeoglobus Fulgidus
Biochemistry V. 44 213 2005
PubMed-ID: 15628862 | Reference-DOI: 10.1021/BI048267O

Molecule 1 - MYO-INOSITOL-1-PHOSPHATE SYNTHASE
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Plasmid	:	PET23+
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	ARCHAEOGLOBUS FULGIDUS
	Organism Taxid	:	224325
	Strain	:	DSM 4304
	Synonym	:	INO1, MIPS

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 10)

No.	Name	Count	Type	Full Name
1	K	2	Ligand/Ion	POTASSIUM ION
2	NAD	4	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE
3	PO4	4	Ligand/Ion	PHOSPHATE ION

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	GLY A:226 , GLY A:229 , GLU A:230 , THR A:231 , LYS A:278 , LYS A:306 , LYS A:367	BINDING SITE FOR RESIDUE PO4 A 395
02	AC2	SOFTWARE	THR B:628 , GLY B:629 , GLU B:630 , THR B:631 , LYS B:678 , LYS B:706 , LYS B:767	BINDING SITE FOR RESIDUE PO4 B 795
03	AC3	SOFTWARE	THR C:1028 , GLY C:1029 , GLU C:1030 , THR C:1031 , LYS C:1106 , LYS C:1167 , HOH C:1689	BINDING SITE FOR RESIDUE PO4 C 1195
04	AC4	SOFTWARE	THR D:1428 , GLY D:1429 , GLU D:1430 , THR D:1431 , LYS D:1474 , LYS D:1478 , LYS D:1506 , LYS D:1567	BINDING SITE FOR RESIDUE PO4 D 1595
05	AC5	SOFTWARE	ASP B:704 , ASP B:732 , ALA B:733 , NAD B:796 , HOH B:1602	BINDING SITE FOR RESIDUE K B 797
06	AC6	SOFTWARE	ILE C:811 , ASP C:1104 , ASP C:1132 , NAD C:1196 , HOH C:1601	BINDING SITE FOR RESIDUE K C 1197
07	AC7	SOFTWARE	GLY A:7 , TYR A:9 , GLY A:10 , ILE A:11 , VAL A:12 , HIS A:56 , GLU A:57 , ARG A:59 , THR A:99 , VAL A:147 , ALA A:148 , SER A:149 , THR A:150 , ALA A:181 , TYR A:185 , PHE A:199 , GLY A:226 , THR A:228 , TYR A:260 , ASP A:261 , LEU A:265 , LYS A:274 , ASP A:304 , ASP A:332 , HOH A:1604	BINDING SITE FOR RESIDUE NAD A 396
08	AC8	SOFTWARE	GLY B:407 , TYR B:409 , GLY B:410 , ILE B:411 , VAL B:412 , GLU B:457 , ILE B:458 , ARG B:459 , HIS B:471 , THR B:499 , ALA B:500 , VAL B:547 , ALA B:548 , SER B:549 , THR B:550 , TYR B:585 , PHE B:599 , GLY B:626 , THR B:628 , TYR B:660 , ASP B:661 , LYS B:674 , ASP B:732 , ALA B:736 , K B:797	BINDING SITE FOR RESIDUE NAD B 796
09	AC9	SOFTWARE	GLY C:807 , TYR C:809 , GLY C:810 , ILE C:811 , VAL C:812 , GLU C:857 , ILE C:858 , ARG C:859 , THR C:899 , VAL C:947 , ALA C:948 , SER C:949 , THR C:950 , TYR C:985 , THR C:1000 , PRO C:1001 , ASP C:1025 , GLY C:1026 , THR C:1028 , TYR C:1060 , ASP C:1061 , LYS C:1074 , ASP C:1132 , ALA C:1136 , LYS C:1167 , K C:1197 , HOH C:1601	BINDING SITE FOR RESIDUE NAD C 1196
10	BC1	SOFTWARE	GLY D:1207 , TYR D:1209 , GLY D:1210 , ILE D:1211 , VAL D:1212 , GLU D:1257 , ILE D:1258 , ARG D:1259 , THR D:1299 , ALA D:1300 , VAL D:1347 , ALA D:1348 , SER D:1349 , THR D:1350 , TYR D:1385 , PHE D:1399 , ASP D:1425 , GLY D:1426 , THR D:1428 , TYR D:1460 , ASP D:1461 , LYS D:1474 , ASP D:1532	BINDING SITE FOR RESIDUE NAD D 1596

(no "SS Bond" information available for 1U1I)

(no "Cis Peptide Bond" information available for 1U1I)

(no "SAP(SNP)/Variant" information available for 1U1I)

(no "PROSITE Motif" information available for 1U1I)

(no "Exon" information available for 1U1I)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:392
 aligned with O28480_ARCFU | O28480 from UniProtKB/TrEMBL  Length:392

    Alignment length:392
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390  
        O28480_ARCFU      1 MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK  392
               SCOP domains d1u1ia1 A:1-227,A:333-392 Myo-inositol 1-phosphate synthase                                                                                                                                                                        d1u1ia2 A:228-332 Myo-inositol 1-phosphate synthase                                                      d1u1ia1 A:1-227,A:333-392 Myo-inositol 1-phosphate synthase  SCOP domains
               CATH domains 1u1iA01 A:1-228,A:330-392 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                       1u1iA02 A:229-329 Dihydrodipicolinate Reductase; domain 2                                            1u1iA01 A:1-228,A:330-392 NAD(P)-binding Rossmann-like Domain   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhhhh......hhhhhhhhh..........eeeeee.....hhhhhhhhhhhhhh..hhhhhhhhhhhhh....ee.........................hhhhhhhh..hhhhhh.....eee..........hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhh...eee........hhhhhhhhhh...eeee.....hhhhhhhhhhhhhhh...eeeeeeeeeee.hhhhhhh.hhhhhhhhhhhhhhhhhhhhh...eeeeeeee........eeeeeeeee.hhh.eeeeeeeee.hhhhhhhhhhhhhhhhhhhhhh....ee...hhhhh.........hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1u1i A    1 MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK  392
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390

Chain B from PDB  Type:PROTEIN  Length:392
 aligned with O28480_ARCFU | O28480 from UniProtKB/TrEMBL  Length:392

    Alignment length:392
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390  
        O28480_ARCFU      1 MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK  392
               SCOP domains d1u1ib1 B:401-627,B:733-792 Myo-inositol 1-phosphate synthase                                                                                                                                                                      d1u1ib2 B:628-732 Myo-inositol 1-phosphate synthase                                                      d1u1ib1 B:401-627,B:733-792                                  SCOP domains
               CATH domains 1u1iB01 B:401-628,B:730-792 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                     1u1iB02 B:629-729 Dihydrodipicolinate Reductase; domain 2                                            1u1iB01 B:401-628,B:730-792 NAD(P)-binding Rossmann-like Domain CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh.....eeeeee.....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh...ee..................hhhhh.hhhhhhhhhhhhhhh......eeee................hhhhhhhhhh.......hhhhhhhhhhhh....eee........hhhhhhhhhhhh.eeee....hhhhhhhhhhhhhhhhh..eeeeeeeeeee.hhhhhhh..hhhhhhhhhhh...hhhhhh...eeeeeeee.hhhh...eeeeeeeee.....eeeeeeeee.hhhhhhhhhhhhhhhhhhhhhhh...ee.hhhhhhh.........hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1u1i B  401 MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK  792
                                   410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790

Chain C from PDB  Type:PROTEIN  Length:392
 aligned with O28480_ARCFU | O28480 from UniProtKB/TrEMBL  Length:392

    Alignment length:392
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390  
        O28480_ARCFU      1 MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK  392
               SCOP domains d1u1ic1 C:801-1027,C:1133-1192 Myo-inositol 1-phosphate synthase                                                                                                                                                                   d1u1ic2 C:1028-1132 Myo-inositol 1-phosphate synthase                                                    d1u1ic1 C:801-1027,C:1133-1192                               SCOP domains
               CATH domains 1u1iC01 C:801-1028,C:1130-1192 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                  1u1iC02 C:1029-1129 Dihydrodipicolinate Reductase; domain 2                                          1u1iC01 C:801-1028,C:1130-1192                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh.....eeeeee......hhhhhhhhhhhhh..hhhhhhhhhhhhhh...ee..................hhhhh.hhhhhhhhhhhhhhh.....eeeee..........hhhhhhhhhhhhhhh........hhhhhhhhhhhhh...eee.........hhhhhhhhhh....ee.....hhhhhhhhhhhhhhhh..eeeeeeeeeee.hhhhhhh...hhhhhhhhhhhhhhhhhhh...eeeeeeee........eeeeeeeee.....eeeeeeeee.hhhhhhhhhhhhhhhhhhhhhhh........hhhhh.........hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1u1i C  801 MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK 1192
                                   810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       980       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      1110      1120      1130      1140      1150      1160      1170      1180      1190

Chain D from PDB  Type:PROTEIN  Length:392
 aligned with O28480_ARCFU | O28480 from UniProtKB/TrEMBL  Length:392

    Alignment length:392
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390  
        O28480_ARCFU      1 MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK  392
               SCOP domains d1u1id1 D:1201-1427,D:1533-1592 Myo-inositol 1-phosphate synthase                                                                                                                                                                  d1u1id2 D:1428-1532 Myo-inositol 1-phosphate synthase                                                    d1u1id1 D:1201-1427,D:1533-1592                              SCOP domains
               CATH domains 1u1iD01 D:1201-1428,D:1530-1592 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                 1u1iD02 D:1429-1529 Dihydrodipicolinate Reductase; domain 2                                          1u1iD01 D:1201-1428,D:1530-1592                                 CATH domains
           Pfam domains (1) NAD_binding_5-1u1iD01 D:1201-1589                                                                                                                                                                                                                                                                                                                                                                    --- Pfam domains (1)
           Pfam domains (2) NAD_binding_5-1u1iD02 D:1201-1589                                                                                                                                                                                                                                                                                                                                                                    --- Pfam domains (2)
           Pfam domains (3) NAD_binding_5-1u1iD03 D:1201-1589                                                                                                                                                                                                                                                                                                                                                                    --- Pfam domains (3)
           Pfam domains (4) NAD_binding_5-1u1iD04 D:1201-1589                                                                                                                                                                                                                                                                                                                                                                    --- Pfam domains (4)
           Pfam domains (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Inos-1-P_synth-1u1iD05 D:1429-1533                                                                       ----------------------------------------------------------- Pfam domains (5)
           Pfam domains (6) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Inos-1-P_synth-1u1iD06 D:1429-1533                                                                       ----------------------------------------------------------- Pfam domains (6)
           Pfam domains (7) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Inos-1-P_synth-1u1iD07 D:1429-1533                                                                       ----------------------------------------------------------- Pfam domains (7)
           Pfam domains (8) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Inos-1-P_synth-1u1iD08 D:1429-1533                                                                       ----------------------------------------------------------- Pfam domains (8)
         Sec.struct. author .eeeee...hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh.....eee.ee.....hhhhhhhhhhh.....hhhhhhhhhhhhhhh..ee........................hhhhhhhhhhhhhhhhh...eeeee................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee........hhhhhhhhhh............hhhhhhhhhhhhhhhh..eeeeeeeeeee..hhhhhh..hhhhhhhhhhhhh.hhhhhh...eeeeeeee.hhhh.eeeeeeeeeee.hhh.eeeeeeeeeeehhhhhhhhhhhhhhhhhhhhh......hhhhhhhh.........hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1u1i D 1201 MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK 1592
                                  1210      1220      1230      1240      1250      1260      1270      1280      1290      1300      1310      1320      1330      1340      1350      1360      1370      1380      1390      1400      1410      1420      1430      1440      1450      1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1560      1570      1580      1590

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: FwdE/GAPDH domain-like (188)

Superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain (179)

Family: Dihydrodipicolinate reductase-like (45)

Protein domain: Myo-inositol 1-phosphate synthase (14)

Archaeoglobus fulgidus [TaxId: 2234] (3)

1a	d1u1ia2	A:228-332
1b	d1u1ib2	B:628-732
1c	d1u1ic2	C:1028-1132
1d	d1u1id2	D:1428-1532

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain (179)

Protein domain: Myo-inositol 1-phosphate synthase (14)

Archaeoglobus fulgidus [TaxId: 2234] (3)

2a	d1u1ia1	A:1-227,A:333-392
2b	d1u1ib1	B:401-627,B:733-792
2c	d1u1ic1	C:801-1027,C:1133-1192
2d	d1u1id1	D:1201-1427,D:1533-1592

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Dihydrodipicolinate Reductase; domain 2 (182)

Homologous Superfamily: Dihydrodipicolinate Reductase; domain 2 (178)

Archaeoglobus fulgidus dsm 4304. Organism_taxid: 224325. Strain: dsm 4304. (1)

1a	1u1iA02	A:229-329
1b	1u1iB02	B:629-729
1c	1u1iC02	C:1029-1129
1d	1u1iD02	D:1429-1529

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Archaeoglobus fulgidus dsm 4304. Organism_taxid: 224325. Strain: dsm 4304. (1)

2a	1u1iA01	A:1-228,A:330-392
2b	1u1iB01	B:401-628,B:730-792
2c	1u1iC01	C:801-1028,C:1130-1192
2d	1u1iD01	D:1201-1428,D:1530-1592

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (O28480_ARCFU | O28480)

molecular function
	GO:0004512	inositol-3-phosphate synthase activity	Catalysis of the reaction: D-glucose 6-phosphate = 1D-myo-inositol 3-phosphate. This reaction requires NAD, which dehydrogenates the CHOH group to CO at C-5 of the glucose 6-phosphate, making C-6 into an active methylene, able to condense with the aldehyde at C-1. Finally, the enzyme-bound NADH reconverts C-5 into the CHOH form.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
	GO:0006021	inositol biosynthetic process	The chemical reactions and pathways resulting in the formation of inositol, 1,2,3,4,5,6-cyclohexanehexol, a growth factor for animals and microorganisms.
	GO:0008654	phospholipid biosynthetic process	The chemical reactions and pathways resulting in the formation of phospholipids, any lipid containing phosphoric acid as a mono- or diester.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		K	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1u1i)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1u1i
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	O28480_ARCFU \| O28480
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	O28480_ARCFU \| O28480
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/TrEMBL
	O28480_ARCFU \| O28480	:	3qvs 3qvt 3qvw 3qvx 3qw2

1gr0	MYO-INOSITOL SYNTHASE FROM M. TUBERCULOSIS
1jkf	MYO-INOSITOL SYNTHASE FROM S. CEREVISIAE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 10)

Sites (10, 10)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (2, 8)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File