|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1TZW) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1TZW) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1TZW) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1TZW) |
Exons (0, 0)| (no "Exon" information available for 1TZW) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:142 aligned with NUSB_THEMA | Q9X286 from UniProtKB/Swiss-Prot Length:142 Alignment length:142 10 20 30 40 50 60 70 80 90 100 110 120 130 140 NUSB_THEMA 1 MKTPRRRMRLAVFKALFQHEFRRDEDLEQILEEILDETYDKKAKEDARRYIRGIKENLSMIDDLISRYLEKWSLNRLSVVDRNVLRLATYELLFEKDIPIEVTIDEAIEIAKRYGTENSGKFVNGILDRIAKEHAPKEKFEL 142 SCOP domains d1tzwa_ A: Antitermination factor NusB SCOP domains CATH domains 1tzwA00 A:1-142 N-utilizing Substance Protein B Homolog; Chain A CATH domains Pfam domains -----NusB-1tzwA01 A:6-132 ---------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1tzw A 1 MKTPRRRMRLAVFKALFQHEFRRDEDLEQILEEILDETYDKKAKEDARRYIRGIKENLSMIDDLISRYLEKWSLNRLSVVDRNVLRLATYELLFEKDIPIEVTIDEAIEIAKRYGTENSGKFVNGILDRIAKEHAPKEKFEL 142 10 20 30 40 50 60 70 80 90 100 110 120 130 140
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (NUSB_THEMA | Q9X286)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|