Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE EQUINE INFECTIOUS ANEMIA VIRUS TAT PROTEIN
 
Authors :  P. Roesch, D. Willbold
Date :  07 Jul 94  (Deposition) - 10 Jul 95  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (6x)
Keywords :  Transcription Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Willbold, R. Rosin-Arbesfeld, H. Sticht, R. Frank, P. Rosch
Structure Of The Equine Infectious Anemia Virus Tat Protein.
Science V. 264 1584 1994
PubMed-ID: 7515512
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRANSACTIVATOR PROTEIN
    Cell Line: BL21
    Chains: A
    Engineered: YES
    Expression System Plasmid: BL21
    Expression System Vector Type: PLASMID
    Gene: POTENTIAL
    Organism Scientific: EQUINE INFECTIOUS ANEMIA VIRUS
    Organism Taxid: 11665

 Structural Features

(-) Chains, Units

  
NMR Structure (6x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TVT)

(-) Sites  (0, 0)

(no "Site" information available for 1TVT)

(-) SS Bonds  (1, 1)

NMR Structure
No.Residues
1A:37 -A:40

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TVT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TVT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1TVT)

(-) Exons   (0, 0)

(no "Exon" information available for 1TVT)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:75
 aligned with O89467_9RETR | O89467 from UniProtKB/TrEMBL  Length:78

    Alignment length:75
                                    13        23        33        43        53        63        73     
          O89467_9RETR    4 LADRRIPGTAEENLQKSSGGVPGQNTGGQEARPNYHCQLCFLRSLGIDYLDASLRKKNKQRLKAIQQGRQPQYLL 78
               SCOP domains d1tvta_ A: Transactivation protein TAT                                      SCOP domains
               CATH domains 1tvtA00 A:1-75 Transactivator Protein (TAT, TAT EIAVY)                      CATH domains
               Pfam domains ---Tat-1tvtA01 A:4-65                                            ---------- Pfam domains
         Sec.struct. author ......................hhhhhh............................................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                  1tvt A  1 LEDRRIPGTAEENLQKSSGGVPGQNTGGQEARPNYHCQLCFLRSLGIDYLDASLRKKNKQRLKAIQQGRQPQYLL 75
                                    10        20        30        40        50        60        70     


Chain A from PDB  Type:PROTEIN  Length:75
 aligned with Q9WM01_9RETR | Q9WM01 from UniProtKB/TrEMBL  Length:46

    Alignment length:75
                                                         1                                             
                                     -         -         1        11        21        31        41     
          Q9WM01_9RETR    - -----------------------------EARPNYHCQLCFLRSLGIDYLDASLRKKNKQRLKAIQQGRQPQYLL 46
               SCOP domains d1tvta_ A: Transactivation protein TAT                                      SCOP domains
               CATH domains 1tvtA00 A:1-75 Transactivator Protein (TAT, TAT EIAVY)                      CATH domains
               Pfam domains ---Tat-1tvtA01 A:4-65                                            ---------- Pfam domains
         Sec.struct. author ......................hhhhhh............................................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                  1tvt A  1 LEDRRIPGTAEENLQKSSGGVPGQNTGGQEARPNYHCQLCFLRSLGIDYLDASLRKKNKQRLKAIQQGRQPQYLL 75
                                    10        20        30        40        50        60        70
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Peptides (792)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Few Secondary Structures (1120)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: Tat] (12)

(-) Gene Ontology  (6, 12)

NMR Structure(hide GO term definitions)
Chain A   (O89467_9RETR | O89467)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0044196    host cell nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic host cells.
    GO:0042025    host cell nucleus    A membrane-bounded organelle as it is found in the host cell in which chromosomes are housed and replicated. The host is defined as the larger of the organisms involved in a symbiotic interaction.

Chain A   (Q9WM01_9RETR | Q9WM01)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0044196    host cell nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic host cells.
    GO:0042025    host cell nucleus    A membrane-bounded organelle as it is found in the host cell in which chromosomes are housed and replicated. The host is defined as the larger of the organisms involved in a symbiotic interaction.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1tvt)
 
  Sites
(no "Sites" information available for 1tvt)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1tvt)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tvt
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O89467_9RETR | O89467
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q9WM01_9RETR | Q9WM01
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O89467_9RETR | O89467
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q9WM01_9RETR | Q9WM01
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q9WM01_9RETR | Q9WM01: 1tvs
UniProtKB/TrEMBL
        O89467_9RETR | O89467: 1tvs

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TVT)