|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 4) |
Asymmetric Unit (4, 4)
|
Asymmetric/Biological Unit
|
(no "Cis Peptide Bond" information available for 1TUK) |
(no "SAP(SNP)/Variant" information available for 1TUK) |
(no "PROSITE Motif" information available for 1TUK) |
(no "Exon" information available for 1TUK) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:67 aligned with NLT2G_WHEAT | P82900 from UniProtKB/Swiss-Prot Length:96 Alignment length:67 39 49 59 69 79 89 NLT2G_WHEAT 30 ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLTSCGLAVPHC 96 SCOP domains d1tuka_ A: Non-specific lipid-transfer protein homologue (ns-LTP2) SCOP domains CATH domains 1tukA00 A:1-67 Plant lipid-transfer and hydrophobic proteins CATH domains Pfam domains LTP_2-1tukA01 A:1-38 ----------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 1tuk A 1 ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLTSCGLAVPHC 67 10 20 30 40 50 60
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit(hide GO term definitions) Chain A (NLT2G_WHEAT | P82900)
|
|
|
|
|
|
|