|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 6)| Asymmetric Unit (2, 6) Biological Unit 1 (1, 20) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1TLQ) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1TLQ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1TLQ) |
Exons (0, 0)| (no "Exon" information available for 1TLQ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:161 aligned with YPJQ_BACSU | P54173 from UniProtKB/Swiss-Prot Length:177 Alignment length:161 13 23 33 43 53 63 73 83 93 103 113 123 133 143 153 163 YPJQ_BACSU 4 YTMNEMVDITKDMLNKRGVMIEDIARIVQKLQEKYNPNLPLSVCMENVEKVLNKREIIHAVLTGLALDQLAEQKLLPEPLQHLVETDEPLYGIDEIIPLSIVNVYGSIGLTNFGYLDKEKIGIIKELDESPDGIHTFLDDIVAALAAAAASRIAHTHQDLQ 164 SCOP domains d1tlqa_ A: Hypothetical protein YpjQ SCOP domains CATH domains 1tlqA00 A:6-166 YutG-like CATH domains Pfam domains ------PgpA-1tlqA01 A:12-160 ------ Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1tlq A 6 YTmNEmVDITKDmLNKRGVmIEDIARIVQKLQEKYNPNLPLSVCmENVEKVLNKREIIHAVLTGLALDQLAEQKLLPEPLQHLVETDEPLYGIDEIIPLSIVNVYGSIGLTNFGYLDKEKIGIIKELDESPDGIHTFLDDIVAALAAAAASRIAHTHQDLQ 166 | | 15 | 25 35 45 | 55 65 75 85 95 105 115 125 135 145 155 165 | | 18-MSE 25-MSE 50-MSE 8-MSE 11-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (YPJQ_BACSU | P54173)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|