Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PHOSPHOHEPTOSE ISOMERASE 1
 
Authors :  K. R. Rajashankar, V. Solorzano, R. Kniewel, C. D. Lima, S. K. Burley, New York Sgx Research Center For Structural Genomics (Nysgxrc)
Date :  08 Jun 04  (Deposition) - 22 Jun 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Lipopolysaccharide Biosynthesis, Structural Genomics, Nysgxrc, T1512, Lpc1_camje, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Seetharaman, K. R. Rajashankar, V. Solorzano, R. Kniewel, C. D. Lima, J. B. Bonanno, S. K. Burley, S. Swaminathan
Crystal Structures Of Two Putative Phosphoheptose Isomerases.
Proteins V. 63 1092 2006
PubMed-ID: 16477602  |  Reference-DOI: 10.1002/PROT.20908
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PHOSPHOHEPTOSE ISOMERASE 1
    Chains: A, B, C, D
    EC Number: 5.-.-.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET T7
    Expression System Strain: B834 DE3
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: LPCA1, GMHA1, CJ1149C
    Organism Scientific: CAMPYLOBACTER JEJUNI
    Organism Taxid: 197

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 20)

Asymmetric/Biological Unit (1, 20)
No.NameCountTypeFull Name
1MSE20Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1TK9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TK9)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TK9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TK9)

(-) PROSITE Motifs  (1, 4)

Asymmetric/Biological Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SISPS51464 SIS domain profile.GMHA1_CAMJE33-186
 
 
 		  4A:35-188
B:35-188
C:35-188
D:35-188

(-) Exons   (0, 0)

(no "Exon" information available for 1TK9)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:188
 aligned with GMHA1_CAMJE | Q9PNE6 from UniProtKB/Swiss-Prot  Length:186

    Alignment length:188
                              1                                                                                                                                                                                         
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178        
          GMHA1_CAMJE     - --MINLVEKEWQEHQKIVQASEILKGQIAKVGELLCECLKKGGKILICGNGGSAADAQHFAAELSGRYKKERKALAGIALTTDTSALSAIGNDYGFEFVFSRQVEALGNEKDVLIGISTSGKSPNVLEALKKAKELNMLCLGLSGKGGGMMNKLCDHNLVVPSDDTARIQEMHILIIHTLCQIIDESF 186
               SCOP domains d1tk9a_ A: Phosphoheptose isomerase GmhA1                                                                                                                                                    SCOP domains
               CATH domains -1tk9A00 A:2-188 Glucose-6-phosphate isomerase like protein; domain 1                                                                                                                        CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhh..........eee...hhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee.....hhhhhhhhhhhhhh..eeeeeee.hhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------SIS  PDB: A:35-188 UniProt: 33-186                                                                                                                         PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tk9 A   1 mSLINLVEKEWQEHQKIVQASEILKGQIAKVGELLCECLKKGGKILICGNGGSAADAQHFAAELSGRYKKERKALAGIALTTDTSALSAIGNDYGFEFVFSRQVEALGNEKDVLIGISTSGKSPNVLEALKKAKELNmLCLGLSGKGGGmmNKLCDHNLVVPSDDTARIQEmHILIIHTLCQIIDESF 188
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150|      160       170 |     180        
                            |                                                                                                                                      138-MSE     150-MSE               172-MSE            
                            1-MSE                                                                                                                                               151-MSE                                 


Chain B from PDB  Type:PROTEIN  Length:188
 aligned with GMHA1_CAMJE | Q9PNE6 from UniProtKB/Swiss-Prot  Length:186

    Alignment length:188
                              1                                                                                                                                                                                         
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178        
          GMHA1_CAMJE     - --MINLVEKEWQEHQKIVQASEILKGQIAKVGELLCECLKKGGKILICGNGGSAADAQHFAAELSGRYKKERKALAGIALTTDTSALSAIGNDYGFEFVFSRQVEALGNEKDVLIGISTSGKSPNVLEALKKAKELNMLCLGLSGKGGGMMNKLCDHNLVVPSDDTARIQEMHILIIHTLCQIIDESF 186
               SCOP domains d1tk9b_ B: Phosphoheptose isomerase GmhA1                                                                                                                                                    SCOP domains
               CATH domains -1tk9B00 B:2-188 Glucose-6-phosphate isomerase like protein; domain 1                                                                                                                        CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhh..........eee...hhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeee....hhhhhhhhhhhhhh..eeeeeee.hhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------SIS  PDB: B:35-188 UniProt: 33-186                                                                                                                         PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tk9 B   1 mSLINLVEKEWQEHQKIVQASEILKGQIAKVGELLCECLKKGGKILICGNGGSAADAQHFAAELSGRYKKERKALAGIALTTDTSALSAIGNDYGFEFVFSRQVEALGNEKDVLIGISTSGKSPNVLEALKKAKELNmLCLGLSGKGGGmmNKLCDHNLVVPSDDTARIQEmHILIIHTLCQIIDESF 188
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150|      160       170 |     180        
                            1-MSE                                                                                                                                  138-MSE     150-MSE               172-MSE            
                                                                                                                                                                                151-MSE                                 


Chain C from PDB  Type:PROTEIN  Length:188
 aligned with GMHA1_CAMJE | Q9PNE6 from UniProtKB/Swiss-Prot  Length:186

    Alignment length:188
                              1                                                                                                                                                                                         
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178        
          GMHA1_CAMJE     - --MINLVEKEWQEHQKIVQASEILKGQIAKVGELLCECLKKGGKILICGNGGSAADAQHFAAELSGRYKKERKALAGIALTTDTSALSAIGNDYGFEFVFSRQVEALGNEKDVLIGISTSGKSPNVLEALKKAKELNMLCLGLSGKGGGMMNKLCDHNLVVPSDDTARIQEMHILIIHTLCQIIDESF 186
               SCOP domains d1tk9c_ C: Phosphoheptose isomerase GmhA1                                                                                                                                                    SCOP domains
               CATH domains -1tk9C00 C:2-188 Glucose-6-phosphate isomerase like protein; domain 1                                                                                                                        CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhh..........eee...hhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeee....hhhhhhhhhhhhhh..eeeeeee.hhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------SIS  PDB: C:35-188 UniProt: 33-186                                                                                                                         PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tk9 C   1 mSLINLVEKEWQEHQKIVQASEILKGQIAKVGELLCECLKKGGKILICGNGGSAADAQHFAAELSGRYKKERKALAGIALTTDTSALSAIGNDYGFEFVFSRQVEALGNEKDVLIGISTSGKSPNVLEALKKAKELNmLCLGLSGKGGGmmNKLCDHNLVVPSDDTARIQEmHILIIHTLCQIIDESF 188
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150|      160       170 |     180        
                            1-MSE                                                                                                                                  138-MSE     150-MSE               172-MSE            
                                                                                                                                                                                151-MSE                                 


Chain D from PDB  Type:PROTEIN  Length:188
 aligned with GMHA1_CAMJE | Q9PNE6 from UniProtKB/Swiss-Prot  Length:186

    Alignment length:188
                              1                                                                                                                                                                                         
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178        
          GMHA1_CAMJE     - --MINLVEKEWQEHQKIVQASEILKGQIAKVGELLCECLKKGGKILICGNGGSAADAQHFAAELSGRYKKERKALAGIALTTDTSALSAIGNDYGFEFVFSRQVEALGNEKDVLIGISTSGKSPNVLEALKKAKELNMLCLGLSGKGGGMMNKLCDHNLVVPSDDTARIQEMHILIIHTLCQIIDESF 186
               SCOP domains d1tk9d_ D: Phosphoheptose isomerase GmhA1                                                                                                                                                    SCOP domains
               CATH domains -1tk9D00 D:2-188 Glucose-6-phosphate isomerase like protein; domain 1                                                                                                                        CATH domains
           Pfam domains (1) ----------SIS_2-1tk9D01 D:11-145                                                                                                                 ------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----------SIS_2-1tk9D02 D:11-145                                                                                                                 ------------------------------------------- Pfam domains (2)
           Pfam domains (3) ----------SIS_2-1tk9D03 D:11-145                                                                                                                 ------------------------------------------- Pfam domains (3)
           Pfam domains (4) ----------SIS_2-1tk9D04 D:11-145                                                                                                                 ------------------------------------------- Pfam domains (4)
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhh..........eee...hhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee.....hhhhhhhhhhhhhh..eeeeeee.hhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------SIS  PDB: D:35-188 UniProt: 33-186                                                                                                                         PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tk9 D   1 mSLINLVEKEWQEHQKIVQASEILKGQIAKVGELLCECLKKGGKILICGNGGSAADAQHFAAELSGRYKKERKALAGIALTTDTSALSAIGNDYGFEFVFSRQVEALGNEKDVLIGISTSGKSPNVLEALKKAKELNmLCLGLSGKGGGmmNKLCDHNLVVPSDDTARIQEmHILIIHTLCQIIDESF 188
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150|      160       170 |     180        
                            1-MSE                                                                                                                                  138-MSE     150-MSE               172-MSE            
                                                                                                                                                                                151-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Clan: SIS (53)
(-)
Family: SIS_2 (6)
(-)
Campylobacter jejuni (1)
1aSIS_2-1tk9D01D:11-145
1bSIS_2-1tk9D02D:11-145
1cSIS_2-1tk9D03D:11-145
1dSIS_2-1tk9D04D:11-145

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (GMHA1_CAMJE | Q9PNE6)
molecular function
    GO:0008968    D-sedoheptulose 7-phosphate isomerase activity    Catalysis of the reaction: D-sedoheptulose-7-phosphate = D-alpha,beta-D-heptose 7-phosphate.
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:2001061    D-glycero-D-manno-heptose 7-phosphate biosynthetic process    The chemical reactions and pathways resulting in the formation of a D-glycero-D-manno-heptose 7-phosphate.
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1tk9)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1tk9)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tk9
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GMHA1_CAMJE | Q9PNE6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.-.-.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GMHA1_CAMJE | Q9PNE6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1TK9)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TK9)