|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1TIZ) |
Sites (0, 0)| (no "Site" information available for 1TIZ) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1TIZ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1TIZ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1TIZ) |
PROSITE Motifs (2, 4)
NMR Structure (2, 4)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1TIZ) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:67 aligned with CML34_ARATH | Q9SRP5 from UniProtKB/Swiss-Prot Length:131 Alignment length:67 10 20 30 40 50 60 CML34_ARATH 1 MSAKRVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFTSCIEKML 67 SCOP domains d1tiza_ A: Calmodulin-related protein T21P5.17 SCOP domains CATH domains 1tizA00 A:1-67 EF-hand CATH domains Pfam domains (1) -------------------------------------EF_hand_4-1tizA01 A:38-67 Pfam domains (1) Pfam domains (2) -EF_hand_5-1tizA02 A:2-63 ---- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) EF_HAND_2 PDB: A:2-33 EF_HAND_2 PDB: A:34-67 PROSITE (1) PROSITE (2) ----------EF_HAND_1 -----------------------EF_HAND_1 -------- PROSITE (2) Transcript ------------------------------------------------------------------- Transcript 1tiz A 1 SSAKRVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFTSCIEKML 67 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (2, 2)
NMR Structure
|
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (CML34_ARATH | Q9SRP5)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|