Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE CONSERVED HYPOTHETICAL PROTEIN MP506/MPN330 (GI: 1674200)FROM MYCOPLASMA PNEUMONIAE
 
Authors :  D. Das, N. Oganesyan, H. Yokota, J. Jancarik, R. Kim, S. H. Kim, Berkeley Structural Genomics Center (Bsgc)
Date :  21 May 04  (Deposition) - 07 Dec 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A
Keywords :  Alpha Helical, Structural Genomics, Psi, Protein Structure Initiative, Berkeley Structural Genomics Center, Bsgc, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Das, N. Oganesyan, H. Yokota, R. Pufan, R. Kim, S. H. Kim
Crystal Structure Of The Conserved Hypothetical Protein Mpn330 (Gi: 1674200) From Mycoplasma Pneumoniae.
Proteins V. 58 504 2004
PubMed-ID: 15562512  |  Reference-DOI: 10.1002/PROT.20316
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN MG237 HOMOLOG
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPLIC (PET21A DERIVATIVE)
    Expression System StrainB834
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneMPN330, MP506
    Organism ScientificMYCOPLASMA PNEUMONIAE
    Organism Taxid2104
    SynonymF10_ORF294

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TD6)

(-) Sites  (0, 0)

(no "Site" information available for 1TD6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TD6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TD6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TD6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1TD6)

(-) Exons   (0, 0)

(no "Exon" information available for 1TD6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:286
 aligned with Y330_MYCPN | P75455 from UniProtKB/Swiss-Prot  Length:294

    Alignment length:286
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284      
           Y330_MYCPN     5 PNQFVNHLSALKKHFASYKELREAFNDYHKHNGDELTTFFLHQFDKVMELVKQKDFKTAQSRCEEELAAPYLPKPLVSFFQSLLQLVNHDLLEQQNAALASLPAAKIIELVLQDYPNKLNMIHYLLPKTKAFVKPHLLQRLQFVLTDSELLELKRFSFFQALNQIPGFQGEQVEYFNSKLKQKFTLTLGEFEIAQQPDAKAYFEQLITQIQQLFLKEPVNAEFANEIIDAFLVSYFPLHPPVPLAQLAAKIYEYVSQIVLNEAVNLKDELIKLIVHTLYEQLDRPV 290
               SCOP domains d1td6a_ A: Hypothetical protein MPN330                                                                                                                                                                                                                                                         SCOP domains
               CATH domains 1td6A01 A:5-106 hypothetical protein mp506/mpn330, domain 1                                           1td6A02 A:107-198 hypothetical protein mp506/mpn330, domain 2                               1td6A03 A:199-290 Hypothetical protein mg237 homolog; domain 3                               CATH domains
               Pfam domains DUF3196-1td6A01 A:5-288                                                                                                                                                                                                                                                                     -- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhh........hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..eeeeee....eeeeee........hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1td6 A   5 PNQFVNHLSALKKHFASYKELREAFNDYHKHNGDELTTFFLHQFDKVMELVKQKDFKTAQSRCEEELAAPYLPKPLVSFFQSLLQLVNHDLLEQQNAALASLPAAKIIELVLQDYPNKLNMIHYLLPKTKAFVKPHLLQRLQFVLTDSELLELKRFSFFQALNQIPGFQGEQVEYFNSKLKQKFTLTLGEFEIAQQPDAKAYFEQLITQIQQLFLKEPVNAEFANEIIDAFLVSYFPLHPPVPLAQLAAKIYEYVSQIVLNEAVNLKDELIKLIVHTLYEQLDRPV 290
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (3, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1TD6)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1td6)
 
  Sites
(no "Sites" information available for 1td6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1td6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1td6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Y330_MYCPN | P75455
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Y330_MYCPN | P75455
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1TD6)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TD6)