Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL ANALYSIS OF A PROBABLE EUKARYOTIC D-AMINO ACID TRNA DEACYLASE
 
Authors :  M. A. Robien, W. G. J. Hol, Structural Genomics Of Pathogenic Proto Consortium (Sgpp)
Date :  20 May 04  (Deposition) - 08 Jun 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.93
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C  (2x)
Biol. Unit 3:  D  (2x)
Keywords :  Sgpp, Structural Genomics, Psi, Protein Structure Initiative, Structural Genomics Of Pathogenic Protozoa Consortium, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. A. Robien, W. G. J. Hol, Structural Genomics Of Pathogenic Protozoa
Structural Analysis Of Lmaj005534Aaa, A Probable Eukaryotic D-Amino Acid Trna Deacylase From Leishmania Major
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PROBABLE EUKARYOTIC D-AMINO ACID TRNA DEACYLASE, LMAJ005534AAA
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET14B
    Expression System StrainBL21STAR/DE3
    Expression System Taxid562
    Expression System Vector TypeT7 SYSTEM
    GeneL4171.5
    Organism ScientificLEISHMANIA MAJOR
    Organism Taxid5664

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)AB  
Biological Unit 2 (2x)  C 
Biological Unit 3 (2x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TC5)

(-) Sites  (0, 0)

(no "Site" information available for 1TC5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TC5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TC5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TC5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1TC5)

(-) Exons   (0, 0)

(no "Exon" information available for 1TC5)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:187
 aligned with DTD_LEIMA | P84066 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:187
                                  1                                                                                                                                                                                    
                                  |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       
            DTD_LEIMA     - ------MLQAMDQGHLLVNNVDKYVRAGRGVMVYIAFLSDRDSAPITDEALRHAVGVLLHTKIFTHFSPEKMINQPQSLEECPEMDILIVPQASLGGKVKGRSVQFHQLVAKDVGAALYDRFCHFVRVARGVDESRVDANGAPRSEGDAPKAEGWIKYNSRVISGTFGNRQGLRFESEGPFTHMFDI 181
               SCOP domains d1tc5a_ A: probable eukaryotic D-amino acid tRNA deacylase                                                                                                                                  SCOP domains
               CATH domains 1tc5A00 A:8-194  [code=3.50.80.10, no name defined]                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.eeeee......eeee..eeeeeeeee........hhhhhhhhhhhhhhh........................eeeeee.hhhhheee..eee.....hhhhhhhhhhhhhhhhhhhh..............hhhhh............eee........eeeee.....eeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tc5 A   8 HMTIRVMLQAMDQGHLLVNNVDKYVRAGRGVMVYIAFLSDRDSAPITDEALRHAVGVLLHTKIFTHFSPEKMINQPQSLEECPEMDILIVPQASLGGKVKGRSVQFHQLVAKDVGAALYDRFCHFVRVARGVDESRVDANGAPRSEGDAPKAEGWIKYNSRVISGTFGNRQGLRFESEGPFTHMFDI 194
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       

Chain B from PDB  Type:PROTEIN  Length:187
 aligned with DTD_LEIMA | P84066 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:187
                                  1                                                                                                                                                                                    
                                  |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       
            DTD_LEIMA     - ------MLQAMDQGHLLVNNVDKYVRAGRGVMVYIAFLSDRDSAPITDEALRHAVGVLLHTKIFTHFSPEKMINQPQSLEECPEMDILIVPQASLGGKVKGRSVQFHQLVAKDVGAALYDRFCHFVRVARGVDESRVDANGAPRSEGDAPKAEGWIKYNSRVISGTFGNRQGLRFESEGPFTHMFDI 181
               SCOP domains d1tc5b_ B: probable eukaryotic D-amino acid tRNA deacylase                                                                                                                                  SCOP domains
               CATH domains 1tc5B00 B:8-194  [code=3.50.80.10, no name defined]                                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.eeeee......eeee..eeeeeeeee........hhhhhhhhhhhhhhh........................eeeeee.hhhhheee..eee.....hhhhhhhhhhhhhhhhhhhh..............hhhhh............eee........eeeee.....eeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tc5 B   8 HMTIRVMLQAMDQGHLLVNNVDKYVRAGRGVMVYIAFLSDRDSAPITDEALRHAVGVLLHTKIFTHFSPEKMINQPQSLEECPEMDILIVPQASLGGKVKGRSVQFHQLVAKDVGAALYDRFCHFVRVARGVDESRVDANGAPRSEGDAPKAEGWIKYNSRVISGTFGNRQGLRFESEGPFTHMFDI 194
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       

Chain C from PDB  Type:PROTEIN  Length:186
 aligned with DTD_LEIMA | P84066 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:186
                                 1                                                                                                                                                                                    
                                 |   5        15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175      
            DTD_LEIMA     - -----MLQAMDQGHLLVNNVDKYVRAGRGVMVYIAFLSDRDSAPITDEALRHAVGVLLHTKIFTHFSPEKMINQPQSLEECPEMDILIVPQASLGGKVKGRSVQFHQLVAKDVGAALYDRFCHFVRVARGVDESRVDANGAPRSEGDAPKAEGWIKYNSRVISGTFGNRQGLRFESEGPFTHMFDI 181
               SCOP domains d1tc5c_ C: probable eukaryotic D-amino acid tRNA deacylase                                                                                                                                 SCOP domains
               CATH domains 1tc5C00 C:9-194  [code=3.50.80.10, no name defined]                                                                                                                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeeee.eeeee......eeee..eeeeeeeee........hhhhhhhhhhhhhhh........................eeeeee.hhhhheee..eee.....hhhhhhhhhhhhhhhhhhhh...............................eee........eeee......eeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1tc5 C   9 MTIRVMLQAMDQGHLLVNNVDKYVRAGRGVMVYIAFLSDRDSAPITDEALRHAVGVLLHTKIFTHFSPEKMINQPQSLEECPEMDILIVPQASLGGKVKGRSVQFHQLVAKDVGAALYDRFCHFVRVARGVDESRVDANGAPRSEGDAPKAEGWIKYNSRVISGTFGNRQGLRFESEGPFTHMFDI 194
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188      

Chain D from PDB  Type:PROTEIN  Length:186
 aligned with DTD_LEIMA | P84066 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:186
                                 1                                                                                                                                                                                    
                                 |   5        15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175      
            DTD_LEIMA     - -----MLQAMDQGHLLVNNVDKYVRAGRGVMVYIAFLSDRDSAPITDEALRHAVGVLLHTKIFTHFSPEKMINQPQSLEECPEMDILIVPQASLGGKVKGRSVQFHQLVAKDVGAALYDRFCHFVRVARGVDESRVDANGAPRSEGDAPKAEGWIKYNSRVISGTFGNRQGLRFESEGPFTHMFDI 181
               SCOP domains d1tc5d_ D: probable eukaryotic D-amino acid tRNA deacylase                                                                                                                                 SCOP domains
               CATH domains 1tc5D00 D:9-194  [code=3.50.80.10, no name defined]                                                                                                                                        CATH domains
           Pfam domains (1) -----Tyr_Deacylase-1tc5D01 D:14-194                                                                                                                                                        Pfam domains (1)
           Pfam domains (2) -----Tyr_Deacylase-1tc5D02 D:14-194                                                                                                                                                        Pfam domains (2)
           Pfam domains (3) -----Tyr_Deacylase-1tc5D03 D:14-194                                                                                                                                                        Pfam domains (3)
           Pfam domains (4) -----Tyr_Deacylase-1tc5D04 D:14-194                                                                                                                                                        Pfam domains (4)
         Sec.struct. author .eeeeeeeee.eeeee......eeee..eeeeeeeee........hhhhhhhhhhhhhhh........................eeeeee.hhhhheee..eee.....hhhhhhhhhhhhhhhhhhhh...............................eee........eeee......eeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1tc5 D   9 MTIRVMLQAMDQGHLLVNNVDKYVRAGRGVMVYIAFLSDRDSAPITDEALRHAVGVLLHTKIFTHFSPEKMINQPQSLEECPEMDILIVPQASLGGKVKGRSVQFHQLVAKDVGAALYDRFCHFVRVARGVDESRVDANGAPRSEGDAPKAEGWIKYNSRVISGTFGNRQGLRFESEGPFTHMFDI 194
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric Unit

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (DTD_LEIMA | P84066)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016788    hydrolase activity, acting on ester bonds    Catalysis of the hydrolysis of any ester bond.
biological process
    GO:0019478    D-amino acid catabolic process    The chemical reactions and pathways resulting in the breakdown of D-amino acids, the D-enantiomers of amino acids.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1tc5)
 
  Sites
(no "Sites" information available for 1tc5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1tc5)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tc5
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DTD_LEIMA | P84066
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DTD_LEIMA | P84066
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1TC5)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TC5)