Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PROTEIN EF3133 FROM ENTEROCOCCUS FAECALIS V583, PFAM DUF984
 
Authors :  A. A. Fedorov, E. V. Fedorov, S. C. Almo, S. K. Burley, New York Sgx Res Center For Structural Genomics (Nysgxrc)
Date :  05 May 04  (Deposition) - 22 Jun 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Nysgxrc, Target T1587, Unknown Function, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Structural Genomics (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. A. Fedorov, E. V. Fedorov, S. C. Almo
Crystal Structure Of Conserved Hypothetical Protein [Gi:29377587] From Enterococcus Faecalis V583
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CONSERVED HYPOTHETICAL PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: ENTEROCOCCUS FAECALIS
    Organism Taxid: 226185
    Strain: V583

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1T62)

(-) Sites  (0, 0)

(no "Site" information available for 1T62)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1T62)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1T62)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1T62)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1T62)

(-) Exons   (0, 0)

(no "Exon" information available for 1T62)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:153
 aligned with Q82ZD1_ENTFA | Q82ZD1 from UniProtKB/TrEMBL  Length:156

    Alignment length:158
                                                                                                                                                                                     156  
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150     |  
        Q82ZD1_ENTFA      1 MLKNVEVFWQNFLDKHELDMLMPDVWMFGDGSSEMGNRLGQLVVSGRKTATCSSLDIYKMEEEQLPKAGQYDIILDGQSQPLAIIRTTKVEIMPMNKVSESFAQAEGEGDLTLDYWYEEHARFFKEELAPYQLQFYPDMLLVCQSFEVVDLYTEKE--    -
               SCOP domains d1t62a_ A: Hypothetical protein EF3133                                                                                                                         SCOP domains
               CATH domains 1t62A00 A:1001-1166 Sulfate adenylyltransferase                                                                                                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh......eee.....hhhhhhhhhhhhhh....eeeee................eeeee.....eeeeeeeeeeeeee.hhhhhhhhhhhh-----.hhhhhhhhhhhhhhhh..........eeeeeeeeeee........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1t62 A 1001 MLKNVEVFWQNFLDKHELDMLMPDVWMFGDGSSEMGNRLGQLVVSGRKTATCSSLDIYKMEEEQLPKAGQYDIILDGQSQPLAIIRTTKVEIMPMNKVSESFAQAEG-----LDYWYEEHARFFKEELAPYQLQFYPDMLLVCQSFEVVDLYTHHHHH 1166
                                  1010      1020      1030      1040      1050      1060      1070      1080      1090      1100      |  -  |   1120      1130      1140      1150  ||    
                                                                                                                                   1107  1113                                    1153|    
                                                                                                                                                                                  1162    


Chain B from PDB  Type:PROTEIN  Length:163
 aligned with Q82ZD1_ENTFA | Q82ZD1 from UniProtKB/TrEMBL  Length:156

    Alignment length:166
                                                                                                                                                                                     156          
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150     |   -      
        Q82ZD1_ENTFA      1 MLKNVEVFWQNFLDKHELDMLMPDVWMFGDGSSEMGNRLGQLVVSGRKTATCSSLDIYKMEEEQLPKAGQYDIILDGQSQPLAIIRTTKVEIMPMNKVSESFAQAEGEGDLTLDYWYEEHARFFKEELAPYQLQFYPDMLLVCQSFEVVDLYTEKE----------    -
               SCOP domains d1t62b_ B: Hypothetical protein EF3133                                                                                                                                 SCOP domains
               CATH domains 1t62B00 B:2001-2166 Sulfate adenylyltransferase                                                                                                                        CATH domains
           Pfam domains (1) --------------------------------ASCH-1t62B01 B:2033-2150                                                                                              ---------------- Pfam domains (1)
           Pfam domains (2) --------------------------------ASCH-1t62B02 B:2033-2150                                                                                              ---------------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhhh....eeeeehhhhhhh.........eeeee.....eeeeeeeeeeeeee.hhhhhhhhhhh.---.hhhhhhhhhhhhhhhhhhhhh.......eeeeeeeeeeee.hhhhh......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1t62 B 2001 MLKNVEVFWQNFLDKHELDMLMPDVWMFGDGSSEMGNRLGQLVVSGRKTATCSSLDIYKMEEEQLPKAGQYDIILDGQSQPLAIIRTTKVEIMPMNKVSESFAQAEG---LTLDYWYEEHARFFKEELAPYQLQFYPDMLLVCQSFEVVDLYTEKEEGGSHHHHHH 2166
                                  2010      2020      2030      2040      2050      2060      2070      2080      2090      2100      |  -|     2120      2130      2140      2150      2160      
                                                                                                                                   2107   |                                                       
                                                                                                                                       2111
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: PUA (42)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1T62)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1t62)
 
  Sites
(no "Sites" information available for 1t62)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1t62)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1t62
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q82ZD1_ENTFA | Q82ZD1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q82ZD1_ENTFA | Q82ZD1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1T62)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1T62)