|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1T3V) |
Sites (0, 0)| (no "Site" information available for 1T3V) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1T3V) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1T3V) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1T3V) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1T3V) |
Exons (0, 0)| (no "Exon" information available for 1T3V) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:124 aligned with Q9X2D6_THEMA | Q9X2D6 from UniProtKB/TrEMBL Length:124 Alignment length:124 10 20 30 40 50 60 70 80 90 100 110 120 Q9X2D6_THEMA 1 MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVHDHHHHEHH 124 SCOP domains d1t3va_ A: Hypothetical protein TM1816 SCOP domains CATH domains 1t3vA01 A:1-106 [code=3.30.420.130, no name defined] ------------------ CATH domains Pfam domains ------------Nitro_FeMo-Co-1t3vA01 A:13-105 ------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript 1t3v A 1 MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVHDHHHHEHH 124 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 1T3V)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|