|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (7, 20)
Asymmetric Unit (7, 20)
|
Sites (9, 9)
Asymmetric Unit (9, 9)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1SS4) |
Cis Peptide Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1SS4) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1SS4) |
Exons (0, 0)| (no "Exon" information available for 1SS4) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:149 aligned with Q81F54_BACCR | Q81F54 from UniProtKB/TrEMBL Length:150 Alignment length:149 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 Q81F54_BACCR - -MAKNKLLRMDNVSIVVESLDNAISFFEEIGLNLEGRANVEGEWAGRVTGLGSQCVEIAMMVTPDGHSRIELSRFLTPPTIADHRTAPVNALGYLRVMFTVEDIDEMVSRLTKHGAELVGEVVQYENSYRLCYIRGVEGILIGLAEELG 148 SCOP domains d1ss4a_ A: Hypothetical protein BC1747 SCOP domains CATH domains 1ss4A00 A:0-148 2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1ss4 A 0 AmAKNKLLRmDNVSIVVESLDNAISFFEEIGLNLEGRANVEGEWAGRVTGLGSQCVEIAmmVTPDGHSRIELSRFLTPPTIADHRTAPVNALGYLRVmFTVEDIDEmVSRLTKHGAELVGEVVQYENSYRLCYIRGVEGILIGLAEELG 148 | 9 19 29 39 49 59| 69 79 89 |99 |109 119 129 139 | 9-MSE 59-MSE 97-MSE 106-MSE 1-MSE 60-MSE Chain B from PDB Type:PROTEIN Length:145 aligned with Q81F54_BACCR | Q81F54 from UniProtKB/TrEMBL Length:150 Alignment length:145 13 23 33 43 53 63 73 83 93 103 113 123 133 143 Q81F54_BACCR 4 NKLLRMDNVSIVVESLDNAISFFEEIGLNLEGRANVEGEWAGRVTGLGSQCVEIAMMVTPDGHSRIELSRFLTPPTIADHRTAPVNALGYLRVMFTVEDIDEMVSRLTKHGAELVGEVVQYENSYRLCYIRGVEGILIGLAEELG 148 SCOP domains d1ss4b_ B: Hypothetical protein BC1747 SCOP domains CATH domains 1ss4B00 B:4-148 2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 CATH domains Pfam domains (1) ----------Glyoxalase_2-1ss4B01 B:14-144 ---- Pfam domains (1) Pfam domains (2) ----------Glyoxalase_2-1ss4B02 B:14-144 ---- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1ss4 B 4 NKLLRmDNVSIVVESLDNAISFFEEIGLNLEGRANVEGEWAGRVTGLGSQCVEIAmmVTPDGHSRIELSRFLTPPTIADHRTAPVNALGYLRVmFTVEDIDEmVSRLTKHGAELVGEVVQYENSYRLCYIRGVEGILIGLAEELG 148 | 13 23 33 43 53 || 63 73 83 93 | 103 | 113 123 133 143 9-MSE 59-MSE 97-MSE 106-MSE 60-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1SS4)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|