Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF AQUIFEX AEOLICUS 5,10-METHENYLTETRAHYDROFOLATE SYNTHETASE: NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET QR46
 
Authors :  J. R. Cort, Y. Chiang, T. Acton, M. Wu, G. T. Montelione, M. A. Kennedy, Northeast Structural Genomics Consortium (Nesg)
Date :  15 Mar 04  (Deposition) - 22 Jun 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Structural Genomics, Psi, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Ligase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. R. Cort, Y. Chiang, T. Acton, M. Wu, G. T. Montelione, M. A. Kennedy
Nmr Structure Of Aquifex Aeolicus 5, 10-Methenyltetrahydrofolate Synthetase: Northeast Structural Genomics Consortium Target Qr46
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 5,10-METHENYLTETRAHYDROFOLATE SYNTHETASE
    Chains: A
    EC Number: 6.3.3.2
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET21D
    Expression System Strain: BL21(DE3)PMGK
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: AQ_1731
    Organism Scientific: AQUIFEX AEOLICUS
    Organism Taxid: 63363

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1SOU)

(-) Sites  (0, 0)

(no "Site" information available for 1SOU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SOU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1SOU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SOU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1SOU)

(-) Exons   (0, 0)

(no "Exon" information available for 1SOU)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:194
 aligned with O67621_AQUAE | O67621 from UniProtKB/TrEMBL  Length:186

    Alignment length:194
                                                                                                                                                                                                                   186        
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     |   -    
         O67621_AQUAE     1 MLKSELRKKVLHKRINLSEEERRRLSEKVISNLKSLPEFKKSKKVALYCPIKGEVDLTPLFPEVLKEKELILPKVEGNEISLYRVHSPACLGVGAFGIMEPVEGERVNPEDVDFIAVPGVAFDLEGYRLGFGKGYYDRLLKRVKGLKVGVAYSFQVFERLPRDAWDIPVDVLVTEKNVRRLRDGRS--------   -
               SCOP domains d1soua_ A: Hypothetical protein aq_1731                                                                                                                                                            SCOP domains
               CATH domains 1souA00 A:1-194 NagB/RpiA/CoA transferase-like                                                                                                                                                     CATH domains
               Pfam domains --5-FTHF_cyc-lig-1souA01 A:3-175                                                                                                                                               ------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.eeee.........hhhhhhhhhhhheeeeeee....eeeeee......ee.....ee....eeehhhhh.eeee.................hhhhhhhhh..eeeee.hhhhh..............eee....eee.............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1sou A   1 MLKSELRKKVLHKRINLSEEERRRLSEKVISNLKSLPEFKKSKKVALYCPIKGEVDLTPLFPEVLKEKELILPKVEGNEISLYRVHSPACLGVGAFGIMEPVEGERVNPEDVDFIAVPGVAFDLEGYRLGFGKGYYDRLLKRVKGLKVGVAYSFQVFERLPRDAWDIPVDVLVTEKNVRRLRDGRSLEHHHHHH 194
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: ISOCOT_Fold (53)

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (O67621_AQUAE | O67621)
molecular function
    GO:0030272    5-formyltetrahydrofolate cyclo-ligase activity    Catalysis of the reaction: 5-formyltetrahydrofolate + ATP = 5,10-methenyltetrahydrofolate + ADP + H(+) + phosphate.
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0009396    folic acid-containing compound biosynthetic process    The chemical reactions and pathways resulting in the formation of folic acid and its derivatives.
    GO:0035999    tetrahydrofolate interconversion    The chemical reactions and pathways by which one-carbon (C1) units are transferred between tetrahydrofolate molecules, to synthesise other tetrahydrofolate molecules.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1sou)
 
  Sites
(no "Sites" information available for 1sou)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1sou)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sou
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O67621_AQUAE | O67621
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  6.3.3.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O67621_AQUAE | O67621
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1SOU)

(-) Related Entries Specified in the PDB File

qr46