Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR SOLUTION STRUCTURE OF HUMAN SAPOSIN C IN SDS MICELLES
 
Authors :  C. A. Hawkins, E. De Alba, N. Tjandra
Date :  10 Mar 04  (Deposition) - 01 Mar 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  3 Disulfide Bridges, All Alpha-Helices, Alpha-Helices Connected By Turns, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. A. Hawkins, E. Alba, N. Tjandra
Solution Structure Of Human Saposin C In A Detergent Environment.
J. Mol. Biol. V. 346 1381 2005
PubMed-ID: 15713488  |  Reference-DOI: 10.1016/J.JMB.2004.12.045
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROACTIVATOR POLYPEPTIDE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET-30B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentSAPOSIN C
    GenePSAP
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1SN6)

(-) Sites  (0, 0)

(no "Site" information available for 1SN6)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:5 -A:78
2A:8 -A:72
3A:36 -A:47

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1SN6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

NMR Structure (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042441L349PSAP_HUMANDisease (AGD)121918110AL39P
2UniProtVAR_006945C388FSAP_HUMANDisease (AGD)  ---AC78F

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAP_BPS50015 Saposin B type domain profile.SAP_HUMAN59-142
194-275
311-392
405-486
  1-
-
A:1-80
-

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003949361aENSE00001858117chr10:73611126-73610939188SAP_HUMAN1-14140--
1.2ENST000003949362ENSE00001239781chr10:73594262-73594129134SAP_HUMAN14-58450--
1.3ENST000003949363ENSE00000987087chr10:73591677-7359160375SAP_HUMAN59-83250--
1.4bENST000003949364bENSE00000987088chr10:73591008-73590883126SAP_HUMAN84-125420--
1.5ENST000003949365ENSE00001239733chr10:73588834-73588634201SAP_HUMAN126-192670--
1.6ENST000003949366ENSE00000987090chr10:73587914-73587771144SAP_HUMAN193-240480--
1.7ENST000003949367ENSE00000987091chr10:73585650-7358559457SAP_HUMAN241-259190--
1.10cENST0000039493610cENSE00001239711chr10:73581764-73581633132SAP_HUMAN260-303440--
1.11ENST0000039493611ENSE00000987093chr10:73580092-7357999796SAP_HUMAN304-335321A:1-2525
1.12bENST0000039493612bENSE00000987094chr10:73579657-73579471187SAP_HUMAN336-398631A:26-8055
1.13ENST0000039493613ENSE00000987095chr10:73579379-73579222158SAP_HUMAN398-450531A:81-844
1.14bENST0000039493614bENSE00000987096chr10:73578868-7357878881SAP_HUMAN451-477270--
1.15bENST0000039493615bENSE00000987097chr10:73578481-73578374108SAP_HUMAN478-513360--
1.16eENST0000039493616eENSE00001917960chr10:73577233-735760551179SAP_HUMAN514-524110--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:84
 aligned with SAP_HUMAN | P07602 from UniProtKB/Swiss-Prot  Length:524

    Alignment length:94
                                   320       330       340       350       360       370       380       390       400    
            SAP_HUMAN   311 SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPK 404
               SCOP domains d1sn6a_ A: Saposin C                                                                           SCOP domains
               CATH domains 1sn6A01 A:1-80 NK-Lysin                                                         -------------- CATH domains
               Pfam domains -SapB_1-1sn6A01 A:2-40                  ---SapB_2-1sn6A02 A:44-78             ---------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh....----------.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------P--------------------------------------F---------------- SAPs(SNPs)
                    PROSITE SAP_B  PDB: A:1-80 UniProt: 311-392                                               ------------ PROSITE
           Transcript 1 (1) Exon 1.11  PDB: A:1-25   Exon 1.12b  PDB: A:26-80 UniProt: 336-398 [INCOMPLETE]         ------ Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------1.13    Transcript 1 (2)
                 1sn6 A   1 SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSG----------LVPR  84
                                    10        20        30        40        50        60        70        80         -|   
                                                                                                          80         81   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure

(-) Pfam Domains  (2, 2)

NMR Structure

(-) Gene Ontology  (29, 29)

NMR Structure(hide GO term definitions)
Chain A   (SAP_HUMAN | P07602)
molecular function
    GO:0001664    G-protein coupled receptor binding    Interacting selectively and non-covalently with a G-protein coupled receptor.
    GO:0008047    enzyme activator activity    Binds to and increases the activity of an enzyme.
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007193    adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway    The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds through inhibition of adenylyl cyclase activity and a subsequent decrease in the concentration of cyclic AMP (cAMP).
    GO:0071310    cellular response to organic substance    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
    GO:0048589    developmental growth    The increase in size or mass of an entire organism, a part of an organism or a cell, where the increase in size or mass has the specific outcome of the progression of the organism over time from one condition to another.
    GO:0060742    epithelial cell differentiation involved in prostate gland development    The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell of the prostate gland.
    GO:0006687    glycosphingolipid metabolic process    The chemical reactions and pathways involving glycosphingolipids, any compound with residues of sphingoid and at least one monosaccharide.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0006869    lipid transport    The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:1903206    negative regulation of hydrogen peroxide-induced cell death    Any process that stops, prevents or reduces the frequency, rate or extent of hydrogen peroxide-induced cell death.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0043410    positive regulation of MAPK cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the MAPK cascade.
    GO:0043085    positive regulation of catalytic activity    Any process that activates or increases the activity of an enzyme.
    GO:0060736    prostate gland growth    The increase in size or mass of the prostate gland where the increase in size or mass has the specific outcome of the progression of the gland, from its formation to its mature state.
    GO:0043408    regulation of MAPK cascade    Any process that modulates the frequency, rate or extent of signal transduction mediated by the MAP kinase (MAPK) cascade.
    GO:0010506    regulation of autophagy    Any process that modulates the frequency, rate or extent of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
    GO:0019216    regulation of lipid metabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving lipids.
    GO:0006665    sphingolipid metabolic process    The chemical reactions and pathways involving sphingolipids, any of a class of lipids containing the long-chain amine diol sphingosine or a closely related base (a sphingoid).
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0043202    lysosomal lumen    The volume enclosed within the lysosomal membrane.
    GO:0005765    lysosomal membrane    The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1sn6)
 
  Sites
(no "Sites" information available for 1sn6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1sn6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sn6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SAP_HUMAN | P07602
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  610539
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SAP_HUMAN | P07602
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SAP_HUMAN | P076021m12 1n69 2dob 2gtg 2qyp 2r0r 2r1q 2rb3 2z9a 3bqp 3bqq 4ddj 4uex 4v2o

(-) Related Entries Specified in the PDB File

1m12 NMR SOLUTION STRUCTURE OF HUMAN SAPOSIN C