|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 7)
|
(no "Site" information available for 1SKV) |
(no "SS Bond" information available for 1SKV) |
(no "Cis Peptide Bond" information available for 1SKV) |
(no "SAP(SNP)/Variant" information available for 1SKV) |
(no "PROSITE Motif" information available for 1SKV) |
(no "Exon" information available for 1SKV) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:64 aligned with D63_SSV1 | P20215 from UniProtKB/Swiss-Prot Length:63 Alignment length:64 63 11 21 31 41 51 61 | D63_SSV1 2 SKEVLEKELFEMLDEDVRELLSLIHEIKIDRITGNMDKQKLGKAYFQVQKIEAELYQLIKVS-- - SCOP domains d1skva_ A: Hypothetical protein D-63 SCOP domains CATH domains 1skvA00 A:2-65 Helix hairpin bin CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 1skv A 2 SKEVLEKELFEmLDEDVRELLSLIHEIKIDRITGNmDKQKLGKAYFQVQKIEAELYQLIKVSHH 65 11 | 21 31 | 41 51 61 13-MSE 37-MSE Chain B from PDB Type:PROTEIN Length:61 aligned with D63_SSV1 | P20215 from UniProtKB/Swiss-Prot Length:63 Alignment length:61 63 15 25 35 45 55 | - D63_SSV1 6 LEKELFEMLDEDVRELLSLIHEIKIDRITGNMDKQKLGKAYFQVQKIEAELYQLIKVS--- - SCOP domains d1skvb_ B: Hypothetical protein D-63 SCOP domains CATH domains 1skvB00 B:6-66 Helix hairpin bin CATH domains Pfam domains ------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------- Transcript 1skv B 6 LEKELFEmLDEDVRELLSLIHEIKIDRITGNmDKQKLGKAYFQVQKIEAELYQLIKVSHHH 66 |15 25 35 | 45 55 65 13-MSE 37-MSE Chain C from PDB Type:PROTEIN Length:58 aligned with D63_SSV1 | P20215 from UniProtKB/Swiss-Prot Length:63 Alignment length:58 63 16 26 36 46 56 | D63_SSV1 7 EKELFEMLDEDVRELLSLIHEIKIDRITGNMDKQKLGKAYFQVQKIEAELYQLIKVS- - SCOP domains d1skvc_ C: Hypothetical protein D-63 SCOP domains CATH domains 1skvC00 C:7-64 Helix hairpin bin CATH domains Pfam domains ---------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------- Transcript 1skv C 7 EKELFEmLDEDVRELLSLIHEIKIDRITGNmDKQKLGKAYFQVQKIEAELYQLIKVSH 64 | 16 26 36| 46 56 13-MSE 37-MSE Chain D from PDB Type:PROTEIN Length:56 aligned with D63_SSV1 | P20215 from UniProtKB/Swiss-Prot Length:63 Alignment length:65 63 11 21 31 41 51 61 | D63_SSV1 2 SKEVLEKELFEMLDEDVRELLSLIHEIKIDRITGNMDKQKLGKAYFQVQKIEAELYQLIKVS--- - SCOP domains d1skvd_ D: Hypothetical prot ein D-63 SCOP domains CATH domains 1skvD00 D:2-66 Helix hairpin bin CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 1skv D 2 SKEVLEKELFEmLDEDVRELLSLIHEIK---------KQKLGKAYFQVQKIEAELYQLIKVSHHH 66 11 | 21 | - |41 51 61 13-MSE 29 39
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1SKV) |
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1SKV)
|
|
|
|
|
|
|