Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF POLYKETIDE CYCLASE SNOAL
 
Authors :  A. Sultana, P. Kallio, A. Jansson, J. S. Wang, J. Neimi, P. Mantsala, G. S Structural Proteomics In Europe (Spine)
Date :  04 Mar 04  (Deposition) - 27 Apr 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.35
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (4x)
Biol. Unit 2:  A  (2x)
Keywords :  Anthracyclines, Nogalamycin, Snoal, Aldol Condensation, Lyase, Structural Genomics, Structural Proteomics In Europe, Spine (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Sultana, P. Kallio, A. Jansson, J. S. Wang, J. Niemi, G. Schneider
Structure Of The Polyketide Cyclase Snoal Reveals A Novel Mechanism For Enzymatic Aldol Condensation.
Embo J. V. 23 1911 2004
PubMed-ID: 15071504  |  Reference-DOI: 10.1038/SJ.EMBOJ.7600201
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NOGALONIC ACID METHYL ESTER CYCLASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPBAD/HISB
    Expression System StrainTOP10
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneSNOAL
    Organism ScientificSTREPTOMYCES NOGALATER
    Organism Taxid38314

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (4x)A
Biological Unit 2 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1NGV1Ligand/IonMETHYL 5,7-DIHYDROXY-2-METHYL-4,6,11-TRIOXO-3,4,6,11-TETRAHYDROTETRACENE-1-CARBOXYLATE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1NGV4Ligand/IonMETHYL 5,7-DIHYDROXY-2-METHYL-4,6,11-TRIOXO-3,4,6,11-TETRAHYDROTETRACENE-1-CARBOXYLATE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1NGV2Ligand/IonMETHYL 5,7-DIHYDROXY-2-METHYL-4,6,11-TRIOXO-3,4,6,11-TETRAHYDROTETRACENE-1-CARBOXYLATE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:51 , TRP A:54 , VAL A:55 , PHE A:59 , LEU A:91 , VAL A:92 , GLN A:105 , ASP A:121 , TRP A:122 , PRO A:123 , PHE A:125 , HOH A:371 , HOH A:392 , HOH A:403BINDING SITE FOR RESIDUE NGV A 333

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SJW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1SJW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SJW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1SJW)

(-) Exons   (0, 0)

(no "Exon" information available for 1SJW)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:142
 aligned with Q9RN59_STRNO | Q9RN59 from UniProtKB/TrEMBL  Length:134

    Alignment length:142
                                     1                                                                                                                                    
                                     1        11        21        31        41        51        61        71        81        91       101       111       121       131  
         Q9RN59_STRNO     - ---------MVSAFNTGRTDDVDEYIHPDYLNPATLEHGIHTGPKAFAQLVGWVRATFSEEARLEEVRIEERGPWVKAYLVLYGRHVGRLVGMPPTDRRFSGEQVHLMRIVDGKIRDHRDWPDFQGTLRQLGDPWPDDEGWR 133
               SCOP domains d1sjwa_ A: Nogalonic acid methyl ester cyclase SnoaL                                                                                           SCOP domains
               CATH domains 1sjwA00 A:2-143  [code=3.10.450.50, no name defined]                                                                                           CATH domains
               Pfam domains ---------SnoaL-1sjwA01 A:11-132                                                                                                    ----------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh...hhhh.eeeeeehhhhhhhh..hhhhhhhhhhhhhhhhhh...eeeeeeeeee..eeeeeeeeeee.............eeeeeeeeeeeee..eeeeeeeeehhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1sjw A   2 SRQTEIVRRMVSAFNTGRTDDVDEYIHPDYLNPATLEHGIHTGPKAFAQLVGWVRATFSEEARLEEVRIEERGPWVKAYLVLYGRHVGRLVGMPPTDRRFSGEQVHLMRIVDGKIRDHRDWPDFQGTLRQLGDPWPDDEGWR 143
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: NTF2 (66)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1SJW)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NGV  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1sjw)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sjw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9RN59_STRNO | Q9RN59
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9RN59_STRNO | Q9RN59
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1SJW)

(-) Related Entries Specified in the PDB File

st_3