Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  1.5 A CRYSTAL STRUCTURE OF A PROTEIN OF UNKNOWN FUNCTION PA5026 FROM PSEUDOMONAS AERUGINOSA, PROBABLE THIOESTERASE
 
Authors :  R. Zhang, E. Evdokimova, A. Savchenko, A. Edwards, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  25 Feb 04  (Deposition) - 06 Jul 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Pseudomonas Aeruginosa, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Zhang, E. Evdokimova, A. Savchenko, A. Edwards, A. Joachimiak
1. 5A Crystal Structure Of A Hypothetical Protein Pa5026 From Pseudomonas Aeruginosa
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN PA5026
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET15B
    Expression System Strain: BL21 (DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: PSEUDOMONAS AERUGINOSA
    Organism Taxid: 287
    Strain: PA5026

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1SH8)

(-) Sites  (0, 0)

(no "Site" information available for 1SH8)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SH8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1SH8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SH8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1SH8)

(-) Exons   (0, 0)

(no "Exon" information available for 1SH8)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:153
 aligned with Q9HUE3_PSEAE | Q9HUE3 from UniProtKB/TrEMBL  Length:150

    Alignment length:153
                             1                                                                                                                                                  150  
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149|  
         Q9HUE3_PSEAE     - -MPLPTELARHLTEEKIAFVQRSGLRAEVLEPGYVRLRMPGAGNENHIGSMYAGALFTLAELPGGALFLTSFDSARFYPIVKEMTLRFRRPAKGDIRVEARLDAERIRQLETEAGERGKAEYSLELQLTDEQGEVVAESAALYQLRSHARP--   -
               SCOP domains d1sh8a_ A: Hypothetical protein PA5026                                                                                                                    SCOP domains
               CATH domains 1sh8A00 A:0-152  [code=3.10.129.10, no name defined]                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhh..eeeeee..eeeeee............hhhhhhhhhhhhhhhhhhhhh....eeeeeeeeeeee.......eeeeee.hhhhhhhhhhhhhhhheeeeeeeeeee.....eeeeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1sh8 A   0 HMPLPTELARHLTEEKIAFVQRSGLRAEVLEPGYVRLRMPGAGNENHIGSMYAGALFTLAELPGGALFLTSFDSARFYPIVKEMTLRFRRPAKGDIRVEARLDAERIRQLETEAGERGKAEYSLELQLTDEQGEVVAESAALYQLRSHARPGS 152
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149   


Chain B from PDB  Type:PROTEIN  Length:149
 aligned with Q9HUE3_PSEAE | Q9HUE3 from UniProtKB/TrEMBL  Length:150

    Alignment length:149
                              1                                                                                                                                                  
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138         
         Q9HUE3_PSEAE     - --MPLPTELARHLTEEKIAFVQRSGLRAEVLEPGYVRLRMPGAGNENHIGSMYAGALFTLAELPGGALFLTSFDSARFYPIVKEMTLRFRRPAKGDIRVEARLDAERIRQLETEAGERGKAEYSLELQLTDEQGEVVAESAALYQLRSH 147
               SCOP domains d1sh8b_ B: Hypothetical protein PA5026                                                                                                                SCOP domains
               CATH domains 1sh8B00 B:-1-147  [code=3.10.129.10, no name defined]                                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhh...eeeeee..eeeeee............hhhhhhhhhhhhhhhhhhhhh....eeeeeeeeeeee.......eeeeee.hhhhhhhhhhhhhhhheeeeeeeeeee.....eeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1sh8 B  -1 GHMPLPTELARHLTEEKIAFVQRSGLRAEVLEPGYVRLRMPGAGNENHIGSMYAGALFTLAELPGGALFLTSFDSARFYPIVKEMTLRFRRPAKGDIRVEARLDAERIRQLETEAGERGKAEYSLELQLTDEQGEVVAESAALYQLRSH 147
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1SH8)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1SH8)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1sh8)
 
  Sites
(no "Sites" information available for 1sh8)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1sh8)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sh8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9HUE3_PSEAE | Q9HUE3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9HUE3_PSEAE | Q9HUE3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1SH8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1SH8)