Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  BACKBONE SOLUTION STRUCTURE OF MIXED ALPHA/BETA PROTEIN PF1061
 
Authors :  J. H. Prestegard, K. L. Mayer, H. Valafar, Southeast Collaboratory F Structural Genomics (Secsg)
Date :  19 Feb 04  (Deposition) - 13 Apr 04  (Release) - 13 Jul 11  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
NMR Structure *:  A  (1x)
Keywords :  Residual Dipolar Couplings, Structural Genomics, Psi, Protein Structure Initiative, Southeast Collaboratory For Structural Genomics, Secsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Valafar, K. L. Mayer, C. M. Bougault, P. D. Leblond, F. E. Jenney, P. S. Brereton, M. W. Adams, J. H. Prestegard
Backbone Solution Structures Of Proteins Using Residual Dipolar Couplings: Application To A Novel Structural Genomics Target.
J. Struct. Funct. Genom. V. 5 241 2005
PubMed-ID: 15704012  |  Reference-DOI: 10.1007/S10969-005-4899-5

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN PF1061
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET24D BAM
    Expression System Strain: BL21DE3STAR PRIL
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: PF1061
    Organism Scientific: PYROCOCCUS FURIOSUS
    Organism Taxid: 186497
    Strain: DSM 3638

 Structural Features

(-) Chains, Units

  1
NMR Structure : A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1SF0)

(-) Sites  (0, 0)

(no "Site" information available for 1SF0)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SF0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1SF0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SF0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1SF0)

(-) Exons   (0, 0)

(no "Exon" information available for 1SF0)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:68
 aligned with Q8U1Z3_PYRFU | Q8U1Z3 from UniProtKB/TrEMBL  Length:69

    Alignment length:68
                                    11        21        31        41        51        61        
          Q8U1Z3_PYRFU    2 KMIKVKVIGRNIEKEIEWREGMKVRDILRAVGFNTESAIAKVNGKVVLEDDEVKDGDFVEVIPVVSGG 69
               SCOP domains d1sf0a_ A: Hypothetical protein PF1061                               SCOP domains
               CATH domains 1sf0A00 A:2-69  [code=3.10.20.30, no name defined]                   CATH domains
               Pfam domains ---ThiS-1sf0A01 A:5-69                                               Pfam domains
         Sec.struct. author ...eee................hhhhhhhh..........ee..ee...........eee........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                  1sf0 A  2 KMIKVKVIGRNIEKEIEWREGMKVRDILRAVGFNTESAIAKVNGKVVLEDDEVKDGDFVEVIPVVSGG 69
                                    11        21        31        41        51        61
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Ubiquitin (279)

(-) Gene Ontology  (0, 0)

NMR Structure(hide GO term definitions)
    (no "Gene Ontology" information available for 1SF0)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1sf0)
 
  Sites
(no "Sites" information available for 1sf0)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1sf0)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sf0
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8U1Z3_PYRFU | Q8U1Z3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8U1Z3_PYRFU | Q8U1Z3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q8U1Z3_PYRFU | Q8U1Z3: 5lda
UniProtKB/TrEMBL
        Q8U1Z3_PYRFU | Q8U1Z3: 1rws

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1SF0)