|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 4)
Asymmetric Unit (1, 4)
|
Sites (0, 0)| (no "Site" information available for 1SC0) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1SC0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1SC0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1SC0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1SC0) |
Exons (0, 0)| (no "Exon" information available for 1SC0) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:137 aligned with Y1161_HAEIN | P45083 from UniProtKB/Swiss-Prot Length:138 Alignment length:137 11 21 31 41 51 61 71 81 91 101 111 121 131 Y1161_HAEIN 2 LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEATMPVDHRTMQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRLTLSVINL 138 SCOP domains d1sc0a_ A: Hypothetical protein HI1161 SCOP domains CATH domains 1sc0A00 A:2-138 [code=3.10.129.10, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript 1sc0 A 2 LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEATmPVDHRTmQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRLTLSVINL 138 11 21 31 41 | 51 61 71 81 91 101 111 121 131 40-MSE 47-MSE Chain B from PDB Type:PROTEIN Length:137 aligned with Y1161_HAEIN | P45083 from UniProtKB/Swiss-Prot Length:138 Alignment length:137 11 21 31 41 51 61 71 81 91 101 111 121 131 Y1161_HAEIN 2 LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEATMPVDHRTMQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRLTLSVINL 138 SCOP domains d1sc0b_ B: Hypothetical protein HI1161 SCOP domains CATH domains 1sc0B00 B:2-138 [code=3.10.129.10, no name defined] CATH domains Pfam domains (1) ------------------------------------------------4HBT-1sc0B01 B:50-127 ----------- Pfam domains (1) Pfam domains (2) ------------------------------------------------4HBT-1sc0B02 B:50-127 ----------- Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript 1sc0 B 2 LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEATmPVDHRTmQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRLTLSVINL 138 11 21 31 41 | 51 61 71 81 91 101 111 121 131 40-MSE 47-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Y1161_HAEIN | P45083)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|