|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 10)| Asymmetric/Biological Unit (3, 10) |
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1S9U) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1S9U) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1S9U) |
Exons (0, 0)| (no "Exon" information available for 1S9U) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:201 aligned with DMSD_SALTY | Q8ZPK0 from UniProtKB/Swiss-Prot Length:204 Alignment length:207 1 | 7 17 27 37 47 57 67 77 87 97 107 117 127 137 147 157 167 177 187 197 DMSD_SALTY - ---MTTFLQRDDFAVTARVLGALFYYSPESHETAPLVQALLNDDWQAQWPLDAEALAPVAAMFKTHSEESLPQAWQRLFIGPYALPSPPWGSVWLDRESVLFGDSTLALRQWMRENGIQFEMQQNEPEDHFGSLLLLAAWLAENDRHHECEQLLAWHLFPWSSRFLDVFIDHAGHPFYQALGQLARLTLAQWQAQLIIPVAVKPLFR 204 SCOP domains d1s9ua_ A: Putative component of anaerobic dehydrogenases YnfI SCOP domains CATH domains 1s9uA00 A:-2-204 TorD-like CATH domains Pfam domains ---------------------------------Nitrate_red_del-1s9uA01 A:31-166 -------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1s9u A -2 SDAmTTFLQRDEFAVTARVLGALFYYSPESHETAPLVQALLNDDWQAQWPLDAEALAPVAAmFKTHSEESLPQAWQRLFIGPYALPSPPWGSVWLDRESVLFGDSTLALRQWmRENGIQ------EPEDHFGSLLLLAAWLAENDRHHECEQLLAWHLFPWSSRFLDVFIDHAGHPFYQALGQLARLTLAQWQAQLIIPVAVKPLFR 204 | 7 17 27 37 47 57 | 67 77 87 97 107 | |- | 127 137 147 157 167 177 187 197 | 59-MSE 110-MSE16 123 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (DMSD_SALTY | Q8ZPK0)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|