Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF RAB9 COMPLEXED TO GDP REVEALS A DIMER WITH AN ACTIVE CONFORMATION OF SWITCH II
 
Authors :  J. G. Wittmann, M. G. Rudolph
Date :  02 Feb 04  (Deposition) - 11 Jun 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.77
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  A,B  (2x)
Biol. Unit 4:  A,B  (1x)
Biol. Unit 5:  B  (2x)
Keywords :  Intracellular Transport, Vesicular Trafficking, Hemihedral Twinning, Protein Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. G. Wittmann, M. G. Rudolph
Crystal Structure Of Rab9 Complexed To Gdp Reveals A Dimer With An Active Conformation Of Switch Ii.
Febs Lett. V. 568 23 2004
PubMed-ID: 15196914  |  Reference-DOI: 10.1016/J.FEBSLET.2004.05.004
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RAS-RELATED PROTEIN RAB-9A
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneRAB9A, RAB9
    Organism CommonDOG
    Organism ScientificCANIS LUPUS FAMILIARIS
    Organism Taxid9615
    Other DetailsC-TERMINAL TRUNCATION
    StrainFAMILIARIS
    SynonymRAB-9, RAB9 GTPASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B
Biological Unit 3 (2x)AB
Biological Unit 4 (1x)AB
Biological Unit 5 (2x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 10)

Asymmetric Unit (5, 10)
No.NameCountTypeFull Name
1BEZ4Ligand/IonBENZOIC ACID
2CL1Ligand/IonCHLORIDE ION
3GDP2Ligand/IonGUANOSINE-5'-DIPHOSPHATE
4MG1Ligand/IonMAGNESIUM ION
5SR2Ligand/IonSTRONTIUM ION
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1BEZ3Ligand/IonBENZOIC ACID
2CL-1Ligand/IonCHLORIDE ION
3GDP1Ligand/IonGUANOSINE-5'-DIPHOSPHATE
4MG-1Ligand/IonMAGNESIUM ION
5SR-1Ligand/IonSTRONTIUM ION
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1BEZ1Ligand/IonBENZOIC ACID
2CL-1Ligand/IonCHLORIDE ION
3GDP1Ligand/IonGUANOSINE-5'-DIPHOSPHATE
4MG-1Ligand/IonMAGNESIUM ION
5SR-1Ligand/IonSTRONTIUM ION
Biological Unit 3 (2, 12)
No.NameCountTypeFull Name
1BEZ8Ligand/IonBENZOIC ACID
2CL-1Ligand/IonCHLORIDE ION
3GDP4Ligand/IonGUANOSINE-5'-DIPHOSPHATE
4MG-1Ligand/IonMAGNESIUM ION
5SR-1Ligand/IonSTRONTIUM ION
Biological Unit 4 (2, 6)
No.NameCountTypeFull Name
1BEZ4Ligand/IonBENZOIC ACID
2CL-1Ligand/IonCHLORIDE ION
3GDP2Ligand/IonGUANOSINE-5'-DIPHOSPHATE
4MG-1Ligand/IonMAGNESIUM ION
5SR-1Ligand/IonSTRONTIUM ION
Biological Unit 5 (2, 4)
No.NameCountTypeFull Name
1BEZ2Ligand/IonBENZOIC ACID
2CL-1Ligand/IonCHLORIDE ION
3GDP2Ligand/IonGUANOSINE-5'-DIPHOSPHATE
4MG-1Ligand/IonMAGNESIUM ION
5SR-1Ligand/IonSTRONTIUM ION

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:1021 , BEZ A:1502 , GDP A:3400 , HOH A:9005 , HOH A:9009 , HOH A:9024BINDING SITE FOR RESIDUE SR A 2401
02AC2SOFTWARESER B:4021 , GDP B:6400 , HOH B:9007 , HOH B:9015 , HOH B:9019 , HOH B:9033BINDING SITE FOR RESIDUE MG B 5401
03AC3SOFTWAREPHE B:4069 , ARG B:4070 , SER B:4071BINDING SITE FOR RESIDUE SR B 2001
04AC4SOFTWAREARG B:4070 , ARG B:4073 , THR B:4074 , HOH B:9011 , HOH B:9069BINDING SITE FOR RESIDUE CL B 3001
05AC5SOFTWAREGLY A:1017 , VAL A:1018 , GLY A:1019 , LYS A:1020 , SER A:1021 , SER A:1022 , PHE A:1032 , ASN A:1124 , LYS A:1125 , ASP A:1127 , ILE A:1128 , SER A:1154 , ALA A:1155 , LYS A:1156 , BEZ A:1502 , SR A:2401 , HOH A:9009 , HOH A:9024 , HOH A:9026 , HOH A:9081 , HOH A:9085 , HOH A:9152 , HOH A:9224BINDING SITE FOR RESIDUE GDP A 3400
06AC6SOFTWAREGLY B:4017 , VAL B:4018 , GLY B:4019 , LYS B:4020 , SER B:4021 , SER B:4022 , PHE B:4032 , ASN B:4124 , LYS B:4125 , ASP B:4127 , SER B:4154 , ALA B:4155 , LYS B:4156 , MG B:5401 , HOH B:9007 , HOH B:9019 , HOH B:9033 , HOH B:9095 , HOH B:9145 , HOH B:9150 , HOH B:9219BINDING SITE FOR RESIDUE GDP B 6400
07AC7SOFTWAREARG A:1068 , PHE A:1069 , ARG A:1070 , SER A:1071 , LEU A:1072 , BEZ A:1501 , HOH A:9103 , SER B:4071 , HOH B:9043BINDING SITE FOR RESIDUE BEZ A 1500
08AC8SOFTWAREPHE A:1055 , ARG A:1068 , BEZ A:1500 , HOH A:9023 , HOH A:9048 , HOH A:9116 , PRO B:4075 , HOH B:9017BINDING SITE FOR RESIDUE BEZ A 1501
09AC9SOFTWAREHIS A:1038 , THR A:1039 , GLN A:1066 , SR A:2401 , GDP A:3400 , HOH A:9009 , HOH A:9010 , HOH A:9024 , HOH A:9054BINDING SITE FOR RESIDUE BEZ A 1502
10BC1SOFTWARETHR B:4063 , GLU B:4067 , ARG B:4068 , PHE B:4069 , ARG B:4070 , ARG B:4073 , HOH B:9110BINDING SITE FOR RESIDUE BEZ B 1503

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1S8F)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1S8F)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1S8F)

(-) PROSITE Motifs  (1, 1)

Asymmetric Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RABPS51419 small GTPase Rab1 family profile.RAB9A_CANLF3-201  1B:4003-4173
Biological Unit 1 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RABPS51419 small GTPase Rab1 family profile.RAB9A_CANLF3-201  0-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RABPS51419 small GTPase Rab1 family profile.RAB9A_CANLF3-201  1B:4003-4173
Biological Unit 3 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RABPS51419 small GTPase Rab1 family profile.RAB9A_CANLF3-201  2B:4003-4173
Biological Unit 4 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RABPS51419 small GTPase Rab1 family profile.RAB9A_CANLF3-201  1B:4003-4173
Biological Unit 5 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RABPS51419 small GTPase Rab1 family profile.RAB9A_CANLF3-201  2B:4003-4173

(-) Exons   (1, 2)

Asymmetric Unit (1, 2)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSCAFT000000186601ENSCAFE00000128459X:10080937-10081545609RAB9A_CANLF1-2022022A:1005-1174 (gaps)
B:4001-4173 (gaps)
170
173

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:168
 aligned with RAB9A_CANLF | P24408 from UniProtKB/Swiss-Prot  Length:201

    Alignment length:170
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174
         RAB9A_CANLF      5 SSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLA  174
               SCOP domains d1s8fa_ A: Rab9a                                                                                                                                                           SCOP domains
               CATH domains 1s8fA00 A:1005-1174 P-loop containing nucleotide triphosphate hydrolases                                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhhh.......eeeeeeeeeeeeee..eeeeeeeeee..hhhhhhhhhhhh....eeeeeee..hhhhhhhhhhhhhhhhhhhh.--.....eeeeee.........hhhhhhhhhhhh....eee.......hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE RAB  PDB: - UniProt: 3-201                                                                                                                                                 PROSITE
               Transcript 1 Exon 1.1  PDB: A:1005-1174 (gaps) UniProt: 1-202 [INCOMPLETE]                                                                                                              Transcript 1
                1s8f A 1005 SSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADV--PESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLA 1174
                                  1014      1024      1034      1044      1054      1064      1074      1084      1094      1104      1114      1124      1134      1144      1154      1164      1174
                                                                                                                                   1111  |                                                            
                                                                                                                                      1114                                                            

Chain B from PDB  Type:PROTEIN  Length:173
 aligned with RAB9A_CANLF | P24408 from UniProtKB/Swiss-Prot  Length:201

    Alignment length:175
                              1                                                                                                                                                                            
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168     
         RAB9A_CANLF      - --MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVL  173
               SCOP domains d1s8fb_ B: Rab9a                                                                                                                                                                SCOP domains
               CATH domains 1s8fB00 B:3999-4173 P-loop containi  ng nucleotide triphosphate hydrolases                                                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeeeee.....hhhhhhhhhhhh...--..eeeeeeeeeeeeee..eeeeeeeeeee....hhhhhhhhhh...eeeeeee..hhhhhhhhhhhhhhhhhhh...hhhhh.eeeeee.........hhhhhhhhhhhh....eee.......hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----RAB  PDB: B:4003-4173 UniProt: 3-201                                                                                                                                        PROSITE
               Transcript 1 --Exon 1.1  PDB: B:4001-4173 (gaps) UniProt: 1-202 [INCOMPLETE]                                                                                                                 Transcript 1
                1s8f B 3999 GAMAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFD--LFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVL 4173
                                  4008      4018      4028    | 4038      4048      4058      4068      4078      4088      4098      4108      4118      4128      4138      4148      4158      4168     
                                                           4033  |                                                                                                                                         
                                                              4036                                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1S8F)

(-) Gene Ontology  (26, 26)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (RAB9A_CANLF | P24408)
molecular function
    GO:0019003    GDP binding    Interacting selectively and non-covalently with GDP, guanosine 5'-diphosphate.
    GO:0005525    GTP binding    Interacting selectively and non-covalently with GTP, guanosine triphosphate.
    GO:0003924    GTPase activity    Catalysis of the reaction: GTP + H2O = GDP + phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0052405    negative regulation by host of symbiont molecular function    Any process in which an organism stops, prevents, or reduces the frequency, rate or extent of the functional activity of symbiont proteins. The symbiont is defined as the smaller of the organisms involved in a symbiotic interaction.
    GO:0045921    positive regulation of exocytosis    Any process that activates or increases the frequency, rate or extent of exocytosis.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0032880    regulation of protein localization    Any process that modulates the frequency, rate or extent of any process in which a protein is transported to, or maintained in, a specific location.
    GO:0042147    retrograde transport, endosome to Golgi    The directed movement of membrane-bounded vesicles from endosomes back to the trans-Golgi network where they are recycled for further rounds of transport.
    GO:0007264    small GTPase mediated signal transduction    Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0000139    Golgi membrane    The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
    GO:0031410    cytoplasmic vesicle    A vesicle found in the cytoplasm of a cell.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005770    late endosome    A prelysosomal endocytic organelle differentiated from early endosomes by lower lumenal pH and different protein composition. Late endosomes are more spherical than early endosomes and are mostly juxtanuclear, being concentrated near the microtubule organizing center.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045335    phagocytic vesicle    A membrane-bounded intracellular vesicle that arises from the ingestion of particulate material by phagocytosis.
    GO:0030670    phagocytic vesicle membrane    The lipid bilayer surrounding a phagocytic vesicle.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BEZ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1s8f)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1s8f
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RAB9A_CANLF | P24408
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RAB9A_CANLF | P24408
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1S8F)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1S8F)