Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PHENAZINE BIOSYNTHESIS PROTEIN PHZF FAMILY (ENTEROCOCCUS FAECALIS)
 
Authors :  Y. Patskovsky, S. C. Almo, S. K. Burley, New York Sgx Research Cente Structural Genomics (Nysgxrc)
Date :  29 Jan 04  (Deposition) - 17 Feb 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Phenazine, Biosynthesis, Bacteria, Enterococcus, Structural Genomics, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Biosynthetic Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Patskovsky, S. C. Almo
Crystal Structure Of Phenazine Biosynthesis Protein From Enterococcus Faecalis
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PHENAZINE BIOSYNTHESIS PROTEIN PHZF FAMILY
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Organism Scientific: ENTEROCOCCUS FAECALIS
    Organism Taxid: 226185
    Strain: V583

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1S7J)

(-) Sites  (0, 0)

(no "Site" information available for 1S7J)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1S7J)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1S7J)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1S7J)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1S7J)

(-) Exons   (0, 0)

(no "Exon" information available for 1S7J)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:260
 aligned with Q839P3_ENTFA | Q839P3 from UniProtKB/TrEMBL  Length:262

    Alignment length:260
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260
         Q839P3_ENTFA     1 MSYPYYIVDAFAEEVFKGNPAAVYVLEKWLPEAVMQNIAIENNLSETAFTVKEGQSYALRWFTPEREIDLCGHATLATAFVLFNYYSVAEETLHFTSQSGPLAVTKKEEYYYLDFPYILPERIPILPEYEAALGTKIYEAYLGRDLFFVLKDEETVAKITPDFSALKALDLGVGVIVTASGDSVDFVSRTFFPKLRINEDPVCGSAHANLIPYWGKRLNQTTLSAYQVSPRGGFLTCEVKENRVIIGGTAKLFAKGEAYL 260
               SCOP domains d1s7ja_ A: Hypothetical protein EF0119                                                                                                                                                                                                                               SCOP domains
               CATH domains 1s7jA01 A:1-116,A:249-260 Diaminopimelate Epimerase; Chain A, domain 1                                              1s7jA02 A:117-248 Diaminopimelate Epimerase; Chain A, domain 1                                                                      1s7jA01      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee........eeeeeee.....hhhhhhhhhhhhh...eeeeeee..eeeeeee....ee..hhhhhhhhhhhhhhhh.....eeeeee..eeeeeeee..eeeeeee....ee...hhhhhhhhh....eeee...eeee..hhhhhhhh..hhhhhhhh.....eeeeee.....eeeeeeehhhheeee.....hhhhhhhhhhhhhh..eeeeee......eeeeeee..eeeeee.eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1s7j A   1 MSYPYYIVDAFAEEVFKGNPAAVYVLEKWLPEAVMQNIAIENNLSETAFTVKEGQSYALRWFTPEREIDLCGHATLATAFVLFNYYSVAEETLHFTSQSGPLAVTKKEEYYYLDFPYILPERIPILPEYEAALGTKIYEAYLGRDLFFVLKDEETVAKITPDFSALKALDLGVGVIVTASGDSVDFVSRTFFPKLRINEDPVCGSAHANLIPYWGKRLNQTTLSAYQVSPRGGFLTCEVKENRVIIGGTAKLFAKGEAYL 260
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260


Chain B from PDB  Type:PROTEIN  Length:260
 aligned with Q839P3_ENTFA | Q839P3 from UniProtKB/TrEMBL  Length:262

    Alignment length:260
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260
         Q839P3_ENTFA     1 MSYPYYIVDAFAEEVFKGNPAAVYVLEKWLPEAVMQNIAIENNLSETAFTVKEGQSYALRWFTPEREIDLCGHATLATAFVLFNYYSVAEETLHFTSQSGPLAVTKKEEYYYLDFPYILPERIPILPEYEAALGTKIYEAYLGRDLFFVLKDEETVAKITPDFSALKALDLGVGVIVTASGDSVDFVSRTFFPKLRINEDPVCGSAHANLIPYWGKRLNQTTLSAYQVSPRGGFLTCEVKENRVIIGGTAKLFAKGEAYL 260
               SCOP domains d1s7jb_ B: Hypothetical protein EF0119                                                                                                                                                                                                                               SCOP domains
               CATH domains 1s7jB01 B:1-116,B:249-260 Diaminopimelate Epimerase; Chain A, domain 1                                              1s7jB02 B:117-248 Diaminopimelate Epimerase; Chain A, domain 1                                                                      1s7jB01      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee........eeeeeee.....hhhhhhhhhhhhh..eeeeeeee..eeeeeee....ee..hhhhhhhhhhhhhhhh.....eeeeee..eeeeeeee..eeeeee.....ee...hhhhhhhhh....eeee...eeee..hhhhhhhh..hhhhhhhh.....eeeeee.....eeeeeeehhhheeee.....hhhhhhhhhhhhhh..eeeeee......eeeeeee..eeeeee.eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1s7j B   1 MSYPYYIVDAFAEEVFKGNPAAVYVLEKWLPEAVMQNIAIENNLSETAFTVKEGQSYALRWFTPEREIDLCGHATLATAFVLFNYYSVAEETLHFTSQSGPLAVTKKEEYYYLDFPYILPERIPILPEYEAALGTKIYEAYLGRDLFFVLKDEETVAKITPDFSALKALDLGVGVIVTASGDSVDFVSRTFFPKLRINEDPVCGSAHANLIPYWGKRLNQTTLSAYQVSPRGGFLTCEVKENRVIIGGTAKLFAKGEAYL 260
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1S7J)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q839P3_ENTFA | Q839P3)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
biological process
    GO:0009058    biosynthetic process    The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1s7j)
 
  Sites
(no "Sites" information available for 1s7j)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1s7j)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1s7j
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q839P3_ENTFA | Q839P3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q839P3_ENTFA | Q839P3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1S7J)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1S7J)