|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 10)
Asymmetric/Biological Unit (1, 10)
|
Sites (0, 0)| (no "Site" information available for 1S4K) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1S4K) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1S4K) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1S4K) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1S4K) |
Exons (0, 0)| (no "Exon" information available for 1S4K) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:120 aligned with Q8ZPR1_SALTY | Q8ZPR1 from UniProtKB/TrEMBL Length:119 Alignment length:120 1 | 9 19 29 39 49 59 69 79 89 99 109 119 Q8ZPR1_SALTY - -MMNALELQALRRIFDMTIEECTIYITQDNNSATWQRWEAGDIPISPEIIARLKEMKARRQRRINAIVDKINNRIGNNTMRYFPDLSSFQSIYTEGDFIEWKIYQSVAAELFAHDLERLC 119 SCOP domains d1s4ka_ A: Putative cytoplasmic protein YdiL SCOP domains CATH domains 1s4kA00 A:0-119 Putative cytoplasmic protein CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript 1s4k A 0 AmmNALELQALRRIFDmTIEECTIYITQDNNSATWQRWEAGDIPISPEIIARLKEmKARRQRRINAIVDKINNRIGNNTmRYFPDLSSFQSIYTEGDFIEWKIYQSVAAELFAHDLERLC 119 || 9 | 19 29 39 49 | 59 69 79 89 99 109 119 || 16-MSE 55-MSE 79-MSE 1-MSE 2-MSE Chain B from PDB Type:PROTEIN Length:120 aligned with Q8ZPR1_SALTY | Q8ZPR1 from UniProtKB/TrEMBL Length:119 Alignment length:120 1 | 9 19 29 39 49 59 69 79 89 99 109 119 Q8ZPR1_SALTY - -MMNALELQALRRIFDMTIEECTIYITQDNNSATWQRWEAGDIPISPEIIARLKEMKARRQRRINAIVDKINNRIGNNTMRYFPDLSSFQSIYTEGDFIEWKIYQSVAAELFAHDLERLC 119 SCOP domains d1s4kb_ B: Putative cytoplasmic protein YdiL SCOP domains CATH domains 1s4kB00 B:0-119 Putative cytoplasmic protein CATH domains Pfam domains (1) --DUF1870-1s4kB01 B:2-119 Pfam domains (1) Pfam domains (2) --DUF1870-1s4kB02 B:2-119 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript 1s4k B 0 AmmNALELQALRRIFDmTIEECTIYITQDNNSATWQRWEAGDIPISPEIIARLKEmKARRQRRINAIVDKINNRIGNNTmRYFPDLSSFQSIYTEGDFIEWKIYQSVAAELFAHDLERLC 119 || 9 | 19 29 39 49 | 59 69 79 89 99 109 119 1-MSE 16-MSE 55-MSE 79-MSE 2-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q8ZPR1_SALTY | Q8ZPR1)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|