|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1RYQ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1RYQ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1RYQ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1RYQ) |
Exons (0, 0)| (no "Exon" information available for 1RYQ) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:64 aligned with SPT4_PYRFU | Q8U440 from UniProtKB/Swiss-Prot Length:61 Alignment length:64 1 | 7 17 27 37 47 57 SPT4_PYRFU - ---MSEKACRHCHYITSEDRCPVCGSRDLSEEWFDLVIIVDVENSEIAKKIGAKVPGKYAIRVR 61 SCOP domains d1ryqa_ A: SCOP domains CATH domains ---------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 1ryq A -5 HHHHHEKACRHCHYITSEDRCPVCGSRDLSEEWFDLVIIVDVENSEIAKKIGAKVPGKYAIRVR 61 || 7 17 27 37 47 57 -1| 3
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1RYQ) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1RYQ) |
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (SPT4_PYRFU | Q8U440)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|