|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1RYN) |
Sites (0, 0)| (no "Site" information available for 1RYN) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1RYN) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1RYN) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1RYN) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:194 aligned with CRS2_MAIZE | Q9M5P4 from UniProtKB/Swiss-Prot Length:256 Alignment length:198 67 77 87 97 107 117 127 137 147 157 167 177 187 197 207 217 227 237 247 CRS2_MAIZE 58 EYTPWLIAGLGNPGNKYYGTRHNVGFEMVDRIAAEEGITMNTIQSKSLLGIGSIGEVPVLVVKPQSYMNYSGEAIGPLAAYYQVPLRHILLIYDDTSLPNGVLRLQKKGGHGRHNGLQNVIEHLDGRREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQIDTALEQGVDAVRTLVLKGFSGSTERFNLVQKYKFHR 255 SCOP domains d1ryna_ A: Chloroplast group II intron splicing factor Crs2 SCOP domains CATH domains 1rynA00 A:1-198 [code=3.40.50.1470, no name defined] CATH domains Pfam domains -----Pept_tRNA_hydro-1rynA01 A:6-189 --------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ----------------PEPT_TRNA_HYDR------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1ryn A 1 EYTPWLIAGLGNPGNKYYGTRHNVGFEMVDRIAAEEGITMNTNQFKSLLGTGSIGEVPVLVVKPQSYMNYSGEAIGPLAAYYQVPLRHILLIYDDTSLPNGVLRLQKK----RHNGLQNVIEHLDGRREFPRLSIGIGSPPGKMDPRAFLLQKFSSEERVQIDTALEQGVDAVRTLVLKGFSGSTERFNLVQKLEHHH 198 10 20 30 40 50 60 70 80 90 100 | - | 120 130 140 150 160 170 180 190 108 113
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (CRS2_MAIZE | Q9M5P4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|