1RRE - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF E.COLI LON PROTEOLYTIC DOMAIN

Authors :   I. Botos, E. E. Melnikov, S. Cherry, J. E. Tropea, A. G. Khalatova, F. Ras Z. Dauter, M. R. Maurizi, T. V. Rotanova, A. Wlodawer, A. Gustchina

Date :   08 Dec 03 (Deposition) - 03 Feb 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.75

Chains :   Asym./Biol. Unit : A,B,C,D,E,F

Keywords :   Atp-Dependent Protease, Catalytic Ser-Lys Dyad, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   I. Botos, E. E. Melnikov, S. Cherry, J. E. Tropea, A. G. Khalatova, F. Rasulova, Z. Dauter, M. R. Maurizi, T. V. Rotanova, A. Wlodawer, A. Gustchina
The Catalytic Domain Of Escherichia Coli Lon Protease Has A Unique Fold And A Ser-Lys Dyad In The Active Site
J. Biol. Chem. V. 279 8140 2004
PubMed-ID: 14665623 | Reference-DOI: 10.1074/JBC.M312243200

Molecule 1 - ATP-DEPENDENT PROTEASE LA
	Chains	:	A, B, C, D, E, F
	EC Number	:	3.4.21.53
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	PROTEOLYTIC DOMAIN
	Gene	:	LON, CAPR, DEG, MUC, LOPA, B0439, C0555
	Mutation	:	YES
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562

		1	2	3	4	5	6
Asymmetric/Biological Unit	:	A	B	C	D	E	F

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 24)

No.	Name	Count	Type	Full Name
1	MSE	19	Mod. Amino Acid	SELENOMETHIONINE
2	SO4	5	Ligand/Ion	SULFATE ION

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TRP B:603 , PRO B:678 , ALA B:679 , ILE B:716 , GLY B:717 , LYS B:722 , HOH B:1213 , HOH B:1225	BINDING SITE FOR RESIDUE SO4 B 1201
2	AC2	SOFTWARE	TRP C:603 , GLY C:677 , PRO C:678 , ALA C:679 , ILE C:716 , GLY C:717 , LYS C:722 , HOH C:1310 , HOH C:1325	BINDING SITE FOR RESIDUE SO4 C 1301
3	AC3	SOFTWARE	TRP D:603 , ALA D:679 , GLY D:717 , LYS D:722 , HOH D:1407 , HOH D:1464 , HOH D:1478	BINDING SITE FOR RESIDUE SO4 D 1401
4	AC4	SOFTWARE	PRO E:678 , ALA E:679 , GLY E:717 , LYS E:722 , HOH E:1510	BINDING SITE FOR RESIDUE SO4 E 1501
5	AC5	SOFTWARE	TRP F:603 , GLY F:677 , PRO F:678 , ALA F:679 , ILE F:716 , GLY F:717 , LYS F:722 , HOH F:1608 , HOH F:1663	BINDING SITE FOR RESIDUE SO4 F 1601

Asymmetric/Biological Unit

No.	Residues
1	A:617	-	A:691
2	B:617	-	B:691
3	C:617	-	C:691
4	D:617	-	D:691
5	E:617	-	E:691
6	F:617	-	F:691

Asymmetric/Biological Unit

No.	Residues
1	Pro A:669	-	Glu A:670
2	Pro B:669	-	Glu B:670
3	Pro C:669	-	Glu C:670
4	Pro D:669	-	Glu D:670
5	Pro E:669	-	Glu E:670
6	Pro F:669	-	Glu F:670

(no "SAP(SNP)/Variant" information available for 1RRE)

Asymmetric/Biological Unit (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LON_SER	PS01046	ATP-dependent serine proteases, lon family, serine active site.	LON_ECOLI	676-684	6	A:676-684 B:676-684 C:676-684 D:676-684 E:676-684 F:676-684

(no "Exon" information available for 1RRE)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:182
 aligned with LON_ECOLI | P0A9M0 from UniProtKB/Swiss-Prot  Length:784

    Alignment length:182
                                   603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773  
            LON_ECOLI   594 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP 775
               SCOP domains d1rrea_ A: ATP-dependent protease Lon (La), catalytic domain                                                                                                                           SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee..eeeeeeeeeeeee....eeee...hhhhhhhhhhhhhhhhhhhhhhh........eeeeee.......ee...hhhhhhhhhhhhhhh......eee..ee.....ee...hhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhhheeeee.hhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------LON_SER  ------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rre A 594 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVmQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAmCTALVSCLTGNPVRADVAmTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP 775
                                   603       613       623       633|      643       653       663       673       683|      693       703       713       723       733       743       753       763       773  
                                                                  634-MSE                                           684-MSE            703-MSE

Chain B from PDB  Type:PROTEIN  Length:182
 aligned with LON_ECOLI | P0A9M0 from UniProtKB/Swiss-Prot  Length:784

    Alignment length:182
                                   603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773  
            LON_ECOLI   594 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP 775
               SCOP domains d1rreb_ B: ATP-dependent protease Lon (La), catalytic domain                                                                                                                           SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.ee.....eeeeeeeeee....eeee...hhhhhhhhhhhhhhhhhhhhhhh...hhhhheeeeee.......ee...hhhhhhhhhhhhhhh......eee..ee.....ee...hhhhhhhhhhhh...eeeee.hhhhhhh..........eeeee.hhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------LON_SER  ------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rre B 594 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVmQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAmCTALVSCLTGNPVRADVAmTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP 775
                                   603       613       623       633|      643       653       663       673       683|      693       703       713       723       733       743       753       763       773  
                                                                  634-MSE                                           684-MSE            703-MSE

Chain C from PDB  Type:PROTEIN  Length:182
 aligned with LON_ECOLI | P0A9M0 from UniProtKB/Swiss-Prot  Length:784

    Alignment length:182
                                   603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773  
            LON_ECOLI   594 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP 775
               SCOP domains d1rrec_ C: ATP-dependent protease Lon (La), catalytic domain                                                                                                                           SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee....eeeeeeeeeee....eeee...hhhhhhhhhhhhhhhhhhhhhhh...hhhhheeeeee.......ee...hhhhhhhhhhhhhhh......eee..ee.....ee...hhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhh.eeeee.hhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------LON_SER  ------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rre C 594 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVmQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAmCTALVSCLTGNPVRADVAmTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP 775
                                   603       613       623       633|      643       653       663       673       683|      693       703       713       723       733       743       753       763       773  
                                                                  634-MSE                                           684-MSE            703-MSE

Chain D from PDB  Type:PROTEIN  Length:182
 aligned with LON_ECOLI | P0A9M0 from UniProtKB/Swiss-Prot  Length:784

    Alignment length:182
                                   603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773  
            LON_ECOLI   594 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP 775
               SCOP domains d1rred_ D: ATP-dependent protease Lon (La), catalytic domain                                                                                                                           SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.ee.....eeeeeeeeee....eeee...hhhhhhhhhhhhhhhhhh........hhhhheeeeee.......ee...hhhhhhhhhhhhhhh......eee..ee.....ee...hhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhh.eeeee.hhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------LON_SER  ------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rre D 594 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVmQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAmCTALVSCLTGNPVRADVAmTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP 775
                                   603       613       623       633|      643       653       663       673       683|      693       703       713       723       733       743       753       763       773  
                                                                  634-MSE                                           684-MSE            703-MSE

Chain E from PDB  Type:PROTEIN  Length:191
 aligned with LON_ECOLI | P0A9M0 from UniProtKB/Swiss-Prot  Length:784

    Alignment length:191
                                   603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773       783 
            LON_ECOLI   594 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEPSGMQVVTAK 784
               SCOP domains d1rree_ E: ATP-dependent protease Lon (La), catalytic domain                                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.ee.....eeeeeeeeee....eeee...hhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeeeee.......ee...hhhhhhhhhhhhhhh......eee..ee.....ee...hhhhhhhhhhhh...eeeee.hhhhhhh..hhhhhhhheeeee.hhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------LON_SER  ---------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rre E 594 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVmQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAmCTALVSCLTGNPVRADVAmTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEPSGmQVVTAK 784
                                   603       613       623       633|      643       653       663       673       683|      693       703       713       723       733       743       753       763       773    |  783 
                                                                  634-MSE                                           684-MSE            703-MSE                                                                    778-MSE

Chain F from PDB  Type:PROTEIN  Length:182
 aligned with LON_ECOLI | P0A9M0 from UniProtKB/Swiss-Prot  Length:784

    Alignment length:182
                                   602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752       762       772  
            LON_ECOLI   593 NRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNE 774
               SCOP domains d1rref_ F: ATP-dependent protease Lon (La), catalytic domain                                                                                                                           SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) Lon_C-1rreF01 F:593-773                                                                                                                                                              - Pfam domains (1)
           Pfam domains (2) Lon_C-1rreF02 F:593-773                                                                                                                                                              - Pfam domains (2)
           Pfam domains (3) Lon_C-1rreF03 F:593-773                                                                                                                                                              - Pfam domains (3)
           Pfam domains (4) Lon_C-1rreF04 F:593-773                                                                                                                                                              - Pfam domains (4)
           Pfam domains (5) Lon_C-1rreF05 F:593-773                                                                                                                                                              - Pfam domains (5)
           Pfam domains (6) Lon_C-1rreF06 F:593-773                                                                                                                                                              - Pfam domains (6)
         Sec.struct. author ..eeeeeee.ee.....eeeeeeeeee....eeee...hhhhhhhhhhhhhhhhhh........hhhhheeeeee.......ee...hhhhhhhhhhhhhhh......eee..ee.....ee...hhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhhheeeee.hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------LON_SER  ------------------------------------------------------------------------------------------ PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1rre F 593 NRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVmQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAmCTALVSCLTGNPVRADVAmTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNE 774
                                   602       612       622       632 |     642       652       662       672       682 |     692       702|      712       722       732       742       752       762       772  
                                                                   634-MSE                                           684-MSE            703-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Ribosomal protein S5 domain 2-like (306)

Superfamily: Ribosomal protein S5 domain 2-like (306)

Family: ATP-dependent protease Lon (La), catalytic domain (3)

Protein domain: ATP-dependent protease Lon (La), catalytic domain (3)

Escherichia coli [TaxId: 562] (2)

1a	d1rrea_	A:
1b	d1rreb_	B:
1c	d1rrec_	C:
1d	d1rred_	D:
1e	d1rree_	E:
1f	d1rref_	F:

(no "CATH Domain" information available for 1RRE)

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: S5 (103)

Family: Lon_C (14)

Escherichia coli (strain K12) (3)

1a	Lon_C-1rreF01	F:593-773
1b	Lon_C-1rreF02	F:593-773
1c	Lon_C-1rreF03	F:593-773
1d	Lon_C-1rreF04	F:593-773
1e	Lon_C-1rreF05	F:593-773
1f	Lon_C-1rreF06	F:593-773

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D,E,F (LON_ECOLI | P0A9M0)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0004176	ATP-dependent peptidase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate, to drive the hydrolysis of peptide bonds.
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0033554	cellular response to stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating the organism is under stress. The stress is usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).
	GO:0006515	misfolded or incompletely synthesized protein catabolic process	The chemical reactions and pathways resulting in the breakdown of misfolded or attenuated proteins.
	GO:0030163	protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0009408	response to heat	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Pro A:669 - Glu A:670	[ RasMol ]
		Pro B:669 - Glu B:670	[ RasMol ]
		Pro C:669 - Glu C:670	[ RasMol ]
		Pro D:669 - Glu D:670	[ RasMol ]
		Pro E:669 - Glu E:670	[ RasMol ]
		Pro F:669 - Glu F:670	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1rre
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LON_ECOLI \| P0A9M0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.21.53
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LON_ECOLI \| P0A9M0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	LON_ECOLI \| P0A9M0	:	1qzm 1rr9 2ane 3ljc

1rr9	NATIVE FORM OF THE SAME PROTEIN

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 24)

Sites (5, 5)

SS Bonds (6, 6)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 6)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (0, 0)

Pfam Domains (1, 6)

Gene Ontology (18, 18)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File