Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF L7 DIMER FROM E.COLI
 
Authors :  E. V. Bocharov, A. G. Sobol, K. V. Pavlov, D. M. Korzhnev, V. A. Jaravine, A. T. Gudkov, A. S. Arseniev
Date :  07 Dec 03  (Deposition) - 02 Mar 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B
Keywords :  Protein L7/L12, Ribosome, Nmr (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. V. Bocharov, A. G. Sobol, K. V. Pavlov, D. M. Korzhnev, V. A. Jaravine, A. T. Gudkov, A. S. Arseniev
From Structure And Dynamics Of Protein L7/L12 To Molecular Switching In Ribosome.
J. Biol. Chem. V. 279 17697 2004
PubMed-ID: 14960595  |  Reference-DOI: 10.1074/JBC.M313384200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - 50S RIBOSOMAL PROTEIN L7/L12
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPPR1
    Expression System StrainXL1
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentL7 DIMER
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    SynonymL8

 Structural Features

(-) Chains, Units

  
NMR Structure 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1RQU)

(-) Sites  (0, 0)

(no "Site" information available for 1RQU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1RQU)

(-) Cis Peptide Bonds  (2, 2)

NMR Structure
No.Residues
1Ala A:90 -Pro A:91
2Ala B:90 -Pro B:91

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1RQU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1RQU)

(-) Exons   (0, 0)

(no "Exon" information available for 1RQU)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:120
 aligned with RL7_ECOLI | P0A7K2 from UniProtKB/Swiss-Prot  Length:121

    Alignment length:120
                                    11        21        31        41        51        61        71        81        91       101       111       121
            RL7_ECOLI     2 SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK 121
               SCOP domains d1rqua1 A:1-51                                     d1rqua2 A:52-120 Ribosomal protein L7/12, C-terminal domain           SCOP domains
               CATH domains 1rquA01 A:1-52 Single helix bin                     1rquA02 A:53-120  [code=3.30.1390.10, no name defined]               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhh..hhhhhhhhhhhhhhhh.......................eeeeeee...hhhhhhhhhhhhh..hhhhhhhhhhh..eeeeeeehhhhhhhhhhhhhhhh.eeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1rqu A   1 SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK 120
                                    10        20        30        40        50        60        70        80        90       100       110       120

Chain B from PDB  Type:PROTEIN  Length:120
 aligned with RL7_ECOLI | P0A7K2 from UniProtKB/Swiss-Prot  Length:121

    Alignment length:120
                                    11        21        31        41        51        61        71        81        91       101       111       121
            RL7_ECOLI     2 SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK 121
               SCOP domains d1rqub1 B:1-51                                     d1rqub2 B:52-120 Ribosomal protein L7/12, C-terminal domain           SCOP domains
               CATH domains 1rquB01 B:1-31 Single helix bin---------------------1rquB02 B:53-120  [code=3.30.1390.10, no name defined]               CATH domains
           Pfam domains (1) ----------------------------------------------------Ribosomal_L12-1rquB01 B:53-119                                     - Pfam domains (1)
           Pfam domains (2) ----------------------------------------------------Ribosomal_L12-1rquB02 B:53-119                                     - Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhh..hhhhhhhhhhhhhhhh.......................eeeeeee...hhhhhhhhhhhhh..hhhhhhhhhhh..eeeeeeehhhhhhhhhhhhhhhh.eeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1rqu B   1 SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK 120
                                    10        20        30        40        50        60        70        80        90       100       110       120

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

NMR Structure

(-) CATH Domains  (2, 4)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

NMR Structure

(-) Gene Ontology  (7, 7)

NMR Structure(hide GO term definitions)
Chain A,B   (RL7_ECOLI | P0A7K2)
molecular function
    GO:0003735    structural constituent of ribosome    The action of a molecule that contributes to the structural integrity of the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0022625    cytosolic large ribosomal subunit    The large subunit of a ribosome located in the cytosol.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1rqu)
 
  Sites
(no "Sites" information available for 1rqu)
 
  Cis Peptide Bonds
    Ala A:90 - Pro A:91   [ RasMol ]  
    Ala B:90 - Pro B:91   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1rqu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RL7_ECOLI | P0A7K2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RL7_ECOLI | P0A7K2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RL7_ECOLI | P0A7K21ctf 1rqs 1rqt 1rqv 2bcw 3j7z 4uy8 4v4v 4v4w 4v5m 4v5n 4v7b 4v7d 4v85 4v89 4v9o 5kcs

(-) Related Entries Specified in the PDB File

1ctf1dd31dd41rqs1rqt1rqv
4429