|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1RJJ) |
(no "Site" information available for 1RJJ) |
(no "SS Bond" information available for 1RJJ) |
(no "Cis Peptide Bond" information available for 1RJJ) |
(no "SAP(SNP)/Variant" information available for 1RJJ) |
NMR Structure (1, 2)
|
(no "Exon" information available for 1RJJ) |
NMR StructureChain A from PDB Type:PROTEIN Length:111 aligned with Y5258_ARATH | Q9FK81 from UniProtKB/Swiss-Prot Length:111 Alignment length:111 10 20 30 40 50 60 70 80 90 100 110 Y5258_ARATH 1 MATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKSSVVATP 111 SCOP domains d1rjja_ A: Hypothetical protein AT5G22580 SCOP domains CATH domains 1rjjA00 A:1-111 [code=3.30.70.900, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----S_R_A_B_BARREL PDB: A:6-98 UniProt: 6-98 ------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------- Transcript 1rjj A 1 MATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKSSVVATP 111 10 20 30 40 50 60 70 80 90 100 110 Chain B from PDB Type:PROTEIN Length:111 aligned with Y5258_ARATH | Q9FK81 from UniProtKB/Swiss-Prot Length:111 Alignment length:111 10 20 30 40 50 60 70 80 90 100 110 Y5258_ARATH 1 MATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKSSVVATP 111 SCOP domains d1rjjb_ B: Hypothetical protein AT5G22580 SCOP domains CATH domains 1rjjB00 B:1-111 [code=3.30.70.900, no name defined] CATH domains Pfam domains (1) -----Dabb-1rjjB01 B:6-100 ----------- Pfam domains (1) Pfam domains (2) -----Dabb-1rjjB02 B:6-100 ----------- Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----S_R_A_B_BARREL PDB: B:6-98 UniProt: 6-98 ------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------- Transcript 1rjj B 1 MATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKSSVVATP 111 10 20 30 40 50 60 70 80 90 100 110
|
NMR Structure
|
NMR Structure |
NMR Structure |
NMR Structure(hide GO term definitions) Chain A,B (Y5258_ARATH | Q9FK81)
|
|
|
|
|
|
|