Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  NRDH-REDOXIN OF CORYNEBACTERIUM AMMONIAGENES FORMS A DOMAIN-SWAPPED DIMER
 
Authors :  M. Stehr, Y. Lindqvist
Date :  21 Oct 03  (Deposition) - 04 May 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.69
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Nrdh, Thioredoxin, Glutaredoxin, Redox Protein, Domain Swapping, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Stehr, Y. Lindqvist
Nrdh-Redoxin Of Corynebacterium Ammoniagenes Forms A Domain-Swapped Dimer.
Proteins V. 55 613 2004
PubMed-ID: 15103625  |  Reference-DOI: 10.1002/PROT.20126
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NRDH-REDOXIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PET24
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: NRDH
    Organism Scientific: CORYNEBACTERIUM AMMONIAGENES
    Organism Taxid: 1697

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1R7H)

(-) Sites  (0, 0)

(no "Site" information available for 1R7H)

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:11 -A:14
2B:11 -B:14

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ala A:51 -Pro A:52
2Ala B:51 -Pro B:52

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1R7H)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1R7H)

(-) Exons   (0, 0)

(no "Exon" information available for 1R7H)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:74
 aligned with O69271_CORAM | O69271 from UniProtKB/TrEMBL  Length:75

    Alignment length:74
                                    10        20        30        40        50        60        70    
          O69271_CORAM    1 MSITLYTKPACVQCTATKKALDRAGLAYNTVDISLDDEARDYVMALGYVQAPVVEVDGEHWSGFRPERIKQLQA 74
               SCOP domains d1r7ha_ A: Glutaredoxin-like NRDH-redoxin                                  SCOP domains
               CATH domains -------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhhh....eeee...hhhhhhhhhhh......eeee..eeee..hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------- Transcript
                  1r7h A  1 MSITLYTKPACVQCTATKKALDRAGLAYNTVDISLDDEARDYVMALGYVQAPVVEVDGEHWSGFRPERIKQLQA 74
                                    10        20        30        40        50        60        70    


Chain B from PDB  Type:PROTEIN  Length:74
 aligned with O69271_CORAM | O69271 from UniProtKB/TrEMBL  Length:75

    Alignment length:74
                                    10        20        30        40        50        60        70    
          O69271_CORAM    1 MSITLYTKPACVQCTATKKALDRAGLAYNTVDISLDDEARDYVMALGYVQAPVVEVDGEHWSGFRPERIKQLQA 74
               SCOP domains d1r7hb_ B: Glutaredoxin-like NRDH-redoxin                                  SCOP domains
               CATH domains -------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --Glutaredoxin-1r7hB01 B:3-61                                ------------- Pfam domains (1)
           Pfam domains (2) --Glutaredoxin-1r7hB02 B:3-61                                ------------- Pfam domains (2)
         Sec.struct. author ..eeeee...hhhhhhhhhhhhhh....eeee...hhhhhhhhhhh......eeee..eeee..hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------- Transcript
                  1r7h B  1 MSITLYTKPACVQCTATKKALDRAGLAYNTVDISLDDEARDYVMALGYVQAPVVEVDGEHWSGFRPERIKQLQA 74
                                    10        20        30        40        50        60        70
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1R7H)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Thioredoxin (367)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (O69271_CORAM | O69271)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0015035    protein disulfide oxidoreductase activity    Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
biological process
    GO:0045454    cell redox homeostasis    Any process that maintains the redox environment of a cell or compartment within a cell.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0005623    cell    The basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1r7h)
 
  Sites
(no "Sites" information available for 1r7h)
 
  Cis Peptide Bonds
    Ala A:51 - Pro A:52   [ RasMol ]  
    Ala B:51 - Pro B:52   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1r7h
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O69271_CORAM | O69271
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O69271_CORAM | O69271
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1R7H)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1R7H)