|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1R75) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1R75) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1R75) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1R75) |
Exons (0, 0)| (no "Exon" information available for 1R75) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:110 aligned with P84150_LEIMA | P84150 from UniProtKB/TrEMBL Length:133 Alignment length:121 21 31 41 51 61 71 81 91 101 111 121 131 P84150_LEIMA 12 VTFKNGKPTVKGTKTYPMFSNILYRIADTEARRWAFYNDSKELIIHVAVLFDYDSQIVPLGDTTAFRIDDPDEGNEDDFGKYLCEVDVRPLETQMFVEGSVTGWRVDTLEARTAEDERGYR 132 SCOP domains d1r75a_ A: Unnamed hypothetical protein SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---DUF1935-1r75A01 A:15-124 -------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1r75 A 12 VTFKNGKPTVKGTKTYPMFSNILYRIADTEARRWAFYNDSKELIIHVAVLFDYDSQIVPLGDTTAFRI-----------GKYLCEVDVRPLETQMFVEGSVTGWRVDTLEARTAEDERGYR 132 21 31 41 51 61 71 | - 91 101 111 121 131 79 91
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1R75) |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1R75)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|