|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 10)| Asymmetric/Biological Unit (3, 10) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1R4V) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1R4V) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1R4V) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1R4V) |
Exons (0, 0)| (no "Exon" information available for 1R4V) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:151 aligned with Y328_AQUAE | O66665 from UniProtKB/Swiss-Prot Length:171 Alignment length:151 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 Y328_AQUAE 21 ETMLRPKGFDKLDHYFRTELDIDLTDETIELLLNSVKAAFGKLFYGAEQRARWNGRDFIALADLNITKALEEHIKNFQKIEQDMGVDELLEYIAFIPPVEMNVGEDLKSEYRNIMGGLLLMHADVIKKATGERKPSREAMEFVAQIVDKVF 171 SCOP domains d1r4va_ A: Hypothetical protein Aq_328 SCOP domains CATH domains 1r4vA00 A:21-171 Histone, subunit A CATH domains Pfam domains -----------DUF1931-1r4vA01 A:32-168 --- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1r4v A 21 ETmLRPKGFDKLDHYFRTELDIDLTDETIELLLNSVKAAFGKLFYGAEQRARWNGRDFIALADLNITKALEEHIKNFQKIEQDmGVDELLEYIAFIPPVEmNVGEDLKSEYRNImGGLLLmHADVIKKATGERKPSREAmEFVAQIVDKVF 171 | 30 40 50 60 70 80 90 100 | 110 120| 130 | 140| 150 160 170 | 104-MSE 121-MSE 135-MSE | 160-MSE 23-MSE 141-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Y328_AQUAE | O66665)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|