1R48 - JenaLib

Title :   SOLUTION STRUCTURE OF THE C-TERMINAL CYTOPLASMIC DOMAIN RESIDUES 468-497 OF ESCHERICHIA COLI PROTEIN PROP

Authors :   D. L. Zoetewey, B. P. Tripet, T. G. Kutateladze, M. J. Overduin, J. M. Wood, R. S. Hodges

Date :   03 Oct 03 (Deposition) - 23 Dec 03 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (51x)

Keywords :   Osmosensor, Cytoplasmic, Coiled-Coil, Antiparallel, Two- Stranded Homodimer, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. L. Zoetewey, B. P. Tripet, T. G. Kutateladze, M. J. Overduin, J. M. Wood, R. S. Hodges
Solution Structure Of The C-Terminal Antiparallel Coiled-Coil Domain From Escherichia Coli Osmosensor Prop.
J. Mol. Biol. V. 334 1063 2003
PubMed-ID: 14643666 | Reference-DOI: 10.1016/J.JMB.2003.10.020
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with PROP_ECO57 | P0C0L8 from UniProtKB/Swiss-Prot  Length:500

    Alignment length:51
                                   456       466       476       486       496 
           PROP_ECO57   447 KGATPAASDIQEAKEILVEHYDNIEQKIDDIDHEIADLQAKRTRLVQQHPR 497
               SCOP domains d1r                  48a_ A:                        SCOP domains
               CATH domains --------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------- Pfam domains
         Sec.struct. author ...------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------- Transcript
                 1r48 A   1 CGG------------------DNIEQKIDDIDHEIADLQAKRTRLVQQHPR  33
                              |      -         - |      12        22        32 
                              3                  4

Chain A from PDB  Type:PROTEIN  Length:33
 aligned with PROP_ECOLI | P0C0L7 from UniProtKB/Swiss-Prot  Length:500

    Alignment length:51
                                   456       466       476       486       496 
           PROP_ECOLI   447 KGATPAASDIQEAKEILVEHYDNIEQKIDDIDHEIADLQAKRTRLVQQHPR 497
               SCOP domains d1r                  48a_ A:                        SCOP domains
               CATH domains --------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------- Pfam domains
         Sec.struct. author ...------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------- Transcript
                 1r48 A   1 CGG------------------DNIEQKIDDIDHEIADLQAKRTRLVQQHPR  33
                              |      -         - |      12        22        32 
                              3                  4

Chain B from PDB  Type:PROTEIN  Length:33
 aligned with PROP_ECO57 | P0C0L8 from UniProtKB/Swiss-Prot  Length:500

    Alignment length:51
                                   456       466       476       486       496 
           PROP_ECO57   447 KGATPAASDIQEAKEILVEHYDNIEQKIDDIDHEIADLQAKRTRLVQQHPR 497
               SCOP domains d1r                  48b_ B:                        SCOP domains
               CATH domains --------------------------------------------------- CATH domains
           Pfam domains (1) ---------------------Osmo_CC-1r48B01 B:4-33         Pfam domains (1)
           Pfam domains (2) ---------------------Osmo_CC-1r48B02 B:4-33         Pfam domains (2)
         Sec.struct. author ...------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------- Transcript
                 1r48 B   1 CGG------------------DNIEQKIDDIDHEIADLQAKRTRLVQQHPR  33
                              |      -         - |      12        22        32 
                              3                  4

Chain B from PDB  Type:PROTEIN  Length:33
 aligned with PROP_ECOLI | P0C0L7 from UniProtKB/Swiss-Prot  Length:500

    Alignment length:51
                                   456       466       476       486       496 
           PROP_ECOLI   447 KGATPAASDIQEAKEILVEHYDNIEQKIDDIDHEIADLQAKRTRLVQQHPR 497
               SCOP domains d1r                  48b_ B:                        SCOP domains
               CATH domains --------------------------------------------------- CATH domains
           Pfam domains (1) ---------------------Osmo_CC-1r48B01 B:4-33         Pfam domains (1)
           Pfam domains (2) ---------------------Osmo_CC-1r48B02 B:4-33         Pfam domains (2)
         Sec.struct. author ...------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------- Transcript
                 1r48 B   1 CGG------------------DNIEQKIDDIDHEIADLQAKRTRLVQQHPR  33
                              |      -         - |      12        22        32 
                              3                  4

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (12, 20)

NMR Structure(hide GO term definitions)

Chain A,B (PROP_ECO57 | P0C0L8)

molecular function
	GO:0015293	symporter activity	Enables the active transport of a solute across a membrane by a mechanism whereby two or more species are transported together in the same direction in a tightly coupled process not directly linked to a form of energy other than chemiosmotic energy.
	GO:0022857	transmembrane transporter activity	Enables the transfer of a substance from one side of a membrane to the other.
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain A,B (PROP_ECOLI | P0C0L7)

molecular function
	GO:0015653	glycine betaine:proton symporter activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: glycine betaine(out) + H+(out) = glycine betaine(in) + H+(in).
	GO:0015293	symporter activity	Enables the active transport of a solute across a membrane by a mechanism whereby two or more species are transported together in the same direction in a tightly coupled process not directly linked to a form of energy other than chemiosmotic energy.
	GO:0022857	transmembrane transporter activity	Enables the transfer of a substance from one side of a membrane to the other.
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
	GO:0006865	amino acid transport	The directed movement of amino acids, organic acids containing one or more amino substituents, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0031460	glycine betaine transport	The directed movement of glycine betaine, N-trimethylglycine, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1r48
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PROP_ECO57 \| P0C0L8
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PROP_ECOLI \| P0C0L7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description