Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HAEMOPHILUS INFLUENZAE H9A MUTANT HOLO FERRIC ION-BINDING PROTEIN A
 
Authors :  S. R. Shouldice, R. J. Skene, D. R. Dougan, D. E. Mcree, L. W. Tari, A. B. Schryvers
Date :  28 Aug 03  (Deposition) - 04 Nov 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A
Keywords :  Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. R. Shouldice, R. J. Skene, D. R. Dougan, D. E. Mcree, L. W. Tari, A. B. Schryvers
Presence Of Ferric Hydroxide Clusters In Mutants Of Haemophilus Influenzae Ferric Ion-Binding Protein A
Biochemistry V. 42 11908 2003
PubMed-ID: 14556621  |  Reference-DOI: 10.1021/BI035389S
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - IRON-UTILIZATION PERIPLASMIC PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPT7-7
    Expression System StrainBL21(DE3)/PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneFBPA, HITA, FBP OR HI0097
    MutationYES
    Organism ScientificHAEMOPHILUS INFLUENZAE
    Organism Taxid727
    SynonymMAJOR FERRIC IRON BINDING PROTEIN, IRON-REGULATED 40 KDA PROTEIN, MIRP, FE(3+)- BINDING PROTEIN

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric/Biological Unit (2, 5)
No.NameCountTypeFull Name
1FE3Ligand/IonFE (III) ION
2PO42Ligand/IonPHOSPHATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:195 , FE A:402 , FE A:403 , PO4 A:501 , PO4 A:502 , HOH A:722 , HOH A:801BINDING SITE FOR RESIDUE FE A 401
2AC2SOFTWAREFE A:401 , FE A:403 , PO4 A:502 , HOH A:588 , HOH A:592 , HOH A:722 , HOH A:768BINDING SITE FOR RESIDUE FE A 402
3AC3SOFTWARETYR A:196 , FE A:401 , FE A:402 , PO4 A:501 , PO4 A:502 , HOH A:588 , HOH A:782 , HOH A:800BINDING SITE FOR RESIDUE FE A 403
4AC4SOFTWARESER A:139 , GLY A:140 , ALA A:141 , ASN A:175 , ASN A:193 , TYR A:195 , FE A:401 , FE A:403 , HOH A:722 , HOH A:798 , HOH A:800 , HOH A:801BINDING SITE FOR RESIDUE PO4 A 501
5AC5SOFTWARETYR A:195 , TYR A:196 , ARG A:262 , FE A:401 , FE A:402 , FE A:403 , HOH A:768 , HOH A:782 , HOH A:801BINDING SITE FOR RESIDUE PO4 A 502

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1QVS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1QVS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (8, 8)

Asymmetric/Biological Unit (8, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_FBPA_HAEIN_001 *D24AFBPA_HAEIN  ---  ---AD1A
2UniProtVAR_FBPA_HAEIN_002 *T37AFBPA_HAEIN  ---  ---AT14A
3UniProtVAR_FBPA_HAEIN_003 *T37VFBPA_HAEIN  ---  ---AT14V
4UniProtVAR_FBPA_HAEIN_004 *E59AFBPA_HAEIN  ---  ---AE36A
5UniProtVAR_FBPA_HAEIN_005 *Q103KFBPA_HAEIN  ---  ---AQ80K
6UniProtVAR_FBPA_HAEIN_006 *I119VFBPA_HAEIN  ---  ---AI96V
7UniProtVAR_FBPA_HAEIN_007 *A284VFBPA_HAEIN  ---  ---AA261V
8UniProtVAR_FBPA_HAEIN_008 *I323TFBPA_HAEIN  ---  ---AI300T
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SBP_BACTERIAL_1PS01037 Bacterial extracellular solute-binding proteins, family 1 signature.FBPA_HAEIN120-137  1A:97-114

(-) Exons   (0, 0)

(no "Exon" information available for 1QVS)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:308
 aligned with FBPA_HAEIN | P35755 from UniProtKB/Swiss-Prot  Length:332

    Alignment length:308
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323        
           FBPA_HAEIN    24 DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL 331
               SCOP domains d1qvsa_ A: Ferric-binding protein FbpA                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains 1qvsA02 A:1-101,A:226-277 Periplasmic binding protein-like II                                        1qvsA01 A:102-225,A:278-308 Periplasmic binding protein-like II                                                             1qvsA02 A:1-101,A:226-277                           1qvsA01 A:102-225,A:278-308     CATH domains
               Pfam domains -----SBP_bac_1-1qvsA01 A:6-256                                                                                                                                                                                                                                  ---------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..hhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhhhh...eeee.hhhhhhhhhhh......hhhhhhh..............eeeeeeeeeeeee....hhhhh..hhhhhhhhhhh..eee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhee..hhhhhhhhhhh....eeeeehhhhhhhhhhhhhhhh.eeee.....hhhh.eeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhh..ee............hhhhhh.......hhhhhhhhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) A------------A---------------------A-------------------------------------------K---------------V--------------------------------------------------------------------------------------------------------------------------------------------------------------------V--------------------------------------T-------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------SBP_BACTERIAL_1   -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qvs A   1 DITVYNGQAKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL 308
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: PBP (391)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (FBPA_HAEIN | P35755)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005215    transporter activity    Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0055072    iron ion homeostasis    Any process involved in the maintenance of an internal steady state of iron ions within an organism or cell.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qvs)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1qvs
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FBPA_HAEIN | P35755
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FBPA_HAEIN | P35755
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FBPA_HAEIN | P357551d9v 1mrp 1nnf 1qw0 2o68 2o69 2o6a 3kn7 3kn8 3od7 3odb

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1QVS)