1QU0 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE FIFTH LAMININ G-LIKE MODULE OF THE MOUSE LAMININ ALPHA2 CHAIN

Authors :   E. Hohenester, D. Tisi, J. F. Talts, R. Timpl

Date :   05 Jul 99 (Deposition) - 03 Dec 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.35

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: B,C  (1x)
Biol. Unit 3: C,D  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Beta Sandwich, Calcium-Binding Protein, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. Hohenester, D. Tisi, J. F. Talts, R. Timpl
The Crystal Structure Of A Laminin G-Like Module Reveals The Molecular Basis Of Alpha-Dystroglycan Binding To Laminins, Perlecan, And Agrin.
Mol. Cell V. 4 783 1999
PubMed-ID: 10619025 | Reference-DOI: 10.1016/S1097-2765(00)80388-3
(for further references see the PDB file header)

Molecule 1 - LAMININ ALPHA2 CHAIN
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System Common	:	293-EBNA HUMAN AMBRYONIC KIDNEY CELLS
	Fragment	:	LG5 MODULE
	Mutation	:	YES
	Organism Common	:	HOUSE MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:		B	C
Biological Unit 3 (1x)	:			C	D
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 11)

No.	Name	Count	Type	Full Name
1	CA	4	Ligand/Ion	CALCIUM ION
2	SO4	7	Ligand/Ion	SULFATE ION

Biological Unit 1 (1, 3)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	SO4	3	Ligand/Ion	SULFATE ION

Biological Unit 2 (1, 3)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	SO4	3	Ligand/Ion	SULFATE ION

Biological Unit 3 (1, 4)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	SO4	4	Ligand/Ion	SULFATE ION

Biological Unit 4 (1, 2)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	SO4	2	Ligand/Ion	SULFATE ION

Asymmetric Unit (11, 11)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	SO4 A:801 , HOH A:975 , ASP A:2982 , ASN A:2999 , SER A:3053 , ASP A:3055	BINDING SITE FOR RESIDUE CA A 701
02	AC2	SOFTWARE	CA A:701 , ALA A:3050 , SER A:3051 , THR A:3052 , SER A:3053	BINDING SITE FOR RESIDUE SO4 A 801
03	AC3	SOFTWARE	PRO A:3066 , GLY A:3067 , ARG A:3079 , ARG A:3108	BINDING SITE FOR RESIDUE SO4 A 802
04	AC4	SOFTWARE	SO4 B:803 , HOH B:1035 , ASP B:2982 , ASN B:2999 , SER B:3053 , ASP B:3055	BINDING SITE FOR RESIDUE CA B 702
05	AC5	SOFTWARE	CA B:702 , ASN B:2999 , SER B:3051 , THR B:3052 , SER B:3053 , LYS C:3027	BINDING SITE FOR RESIDUE SO4 B 803
06	AC6	SOFTWARE	SO4 C:804 , HOH C:1133 , HOH C:1164 , ASP C:2982 , ASN C:2999 , SER C:3053 , ASP C:3055	BINDING SITE FOR RESIDUE CA C 703
07	AC7	SOFTWARE	LYS B:3027 , CA C:703 , HOH C:1164 , ASN C:2999 , ALA C:3050 , SER C:3051 , THR C:3052 , SER C:3053	BINDING SITE FOR RESIDUE SO4 C 804
08	AC8	SOFTWARE	PRO C:3066 , GLY C:3067 , ARG C:3079 , ARG C:3108	BINDING SITE FOR RESIDUE SO4 C 805
09	AC9	SOFTWARE	SO4 D:806 , ASP D:2982 , ASN D:2999 , SER D:3053 , ASP D:3055	BINDING SITE FOR RESIDUE CA D 704
10	BC1	SOFTWARE	CA D:704 , ALA D:3050 , SER D:3051 , THR D:3052 , SER D:3053	BINDING SITE FOR RESIDUE SO4 D 806
11	BC2	SOFTWARE	PRO D:3066 , GLY D:3067 , ARG D:3079 , ARG D:3108	BINDING SITE FOR RESIDUE SO4 D 807

Asymmetric Unit

No.	Residues
1	A:3083	-	A:3115
2	B:3083	-	B:3115
3	C:3083	-	C:3115
4	D:3083	-	D:3115

(no "Cis Peptide Bond" information available for 1QU0)

(no "SAP(SNP)/Variant" information available for 1QU0)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LAM_G_DOMAIN	PS50025	Laminin G domain profile.	LAMA2_MOUSE	2141-2324 2336-2517 2522-2706 2759-2930 2935-3115	1	- - - - C:2935-3115

Biological Unit 1 (, 0)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LAM_G_DOMAIN	PS50025	Laminin G domain profile.	LAMA2_MOUSE	2141-2324 2336-2517 2522-2706 2759-2930 2935-3115	0	- - - - -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LAM_G_DOMAIN	PS50025	Laminin G domain profile.	LAMA2_MOUSE	2141-2324 2336-2517 2522-2706 2759-2930 2935-3115	1	- - - - C:2935-3115

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LAM_G_DOMAIN	PS50025	Laminin G domain profile.	LAMA2_MOUSE	2141-2324 2336-2517 2522-2706 2759-2930 2935-3115	1	- - - - C:2935-3115

Biological Unit 4 (, 0)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LAM_G_DOMAIN	PS50025	Laminin G domain profile.	LAMA2_MOUSE	2141-2324 2336-2517 2522-2706 2759-2930 2935-3115	0	- - - - -

(no "Exon" information available for 1QU0)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:181
 aligned with LAMA2_MOUSE | Q60675 from UniProtKB/Swiss-Prot  Length:3118

    Alignment length:181
                                  2945      2955      2965      2975      2985      2995      3005      3015      3025      3035      3045      3055      3065      3075      3085      3095      3105      3115 
         LAMA2_MOUSE   2936 SGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAGIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCP 3116
               SCOP domains d1qu0a_ A: Laminin alpha2 chain                                                                                                                                                       SCOP domains
               CATH domains 1qu0A00 A:2936-3116  [code=2.60.120.200, no name defined]                                                                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeee.........eeeeeeeeee....eeeeeee.....eeeeeee..eeeeeee....eeeeee.....hhhhh...eeeeeeee..eeeeee..eeeeee...............ee..................eeeeeeeeeee........hhhhh.eeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE LAM_G_DOMAIN  PDB: - UniProt: 2935-3115                                                                                                                                             - PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1qu0 A 2936 SGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCP 3116
                                  2945      2955      2965      2975      2985      2995      3005      3015      3025      3035      3045      3055      3065      3075      3085      3095      3105      3115

Chain B from PDB  Type:PROTEIN  Length:181
 aligned with LAMA2_MOUSE | Q60675 from UniProtKB/Swiss-Prot  Length:3118

    Alignment length:181
                                  2945      2955      2965      2975      2985      2995      3005      3015      3025      3035      3045      3055      3065      3075      3085      3095      3105      3115 
         LAMA2_MOUSE   2936 SGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAGIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCP 3116
               SCOP domains d1qu0b_ B: Laminin alpha2 chain                                                                                                                                                       SCOP domains
               CATH domains 1qu0B00 B:2936-3116  [code=2.60.120.200, no name defined]                                                                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeee.........eeeeeeeeee....eeeeeee.....eeeeeee..eeeeeee....eeeeee.....hhhhh...eeeeeeee..eeeeee..eeeeee...............ee..................eeeeeeeeeee........hhhhh.eeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE LAM_G_DOMAIN  PDB: - UniProt: 2935-3115                                                                                                                                             - PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1qu0 B 2936 SGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCP 3116
                                  2945      2955      2965      2975      2985      2995      3005      3015      3025      3035      3045      3055      3065      3075      3085      3095      3105      3115

Chain C from PDB  Type:PROTEIN  Length:183
 aligned with LAMA2_MOUSE | Q60675 from UniProtKB/Swiss-Prot  Length:3118

    Alignment length:183
                                  2944      2954      2964      2974      2984      2994      3004      3014      3024      3034      3044      3054      3064      3074      3084      3094      3104      3114   
         LAMA2_MOUSE   2935 ESGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAGIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPT 3117
               SCOP domains d1qu0c_ C: Laminin alpha2 chain                                                                                                                                                         SCOP domains
               CATH domains 1qu0C00 C:2935-3117  [code=2.60.120.200, no name defined]                                                                                                                               CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeee.........eeeeeeeee.....eeeeeee.....eeeeeee..eeeeeee....eeeeee.....hhhhh...eeeeeeee..eeeeee..eeeeee...............ee..................eeeeeeeeeee.....ee.hhhhh.eeeeee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE LAM_G_DOMAIN  PDB: C:2935-3115 UniProt: 2935-3115                                                                                                                                    -- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1qu0 C 2935 ESGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPT 3117
                                  2944      2954      2964      2974      2984      2994      3004      3014      3024      3034      3044      3054      3064      3074      3084      3094      3104      3114

Chain D from PDB  Type:PROTEIN  Length:181
 aligned with LAMA2_MOUSE | Q60675 from UniProtKB/Swiss-Prot  Length:3118

    Alignment length:181
                                  2945      2955      2965      2975      2985      2995      3005      3015      3025      3035      3045      3055      3065      3075      3085      3095      3105      3115 
         LAMA2_MOUSE   2936 SGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAGIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCP 3116
               SCOP domains d1qu0d_ D: Laminin alpha2 chain                                                                                                                                                       SCOP domains
               CATH domains 1qu0D00 D:2936-3116  [code=2.60.120.200, no name defined]                                                                                                                             CATH domains
           Pfam domains (1) ----------------------------Laminin_G_2-1qu0D01 D:2964-3092                                                                                                  ------------------------ Pfam domains (1)
           Pfam domains (2) ----------------------------Laminin_G_2-1qu0D02 D:2964-3092                                                                                                  ------------------------ Pfam domains (2)
           Pfam domains (3) ----------------------------Laminin_G_2-1qu0D03 D:2964-3092                                                                                                  ------------------------ Pfam domains (3)
           Pfam domains (4) ----------------------------Laminin_G_2-1qu0D04 D:2964-3092                                                                                                  ------------------------ Pfam domains (4)
         Sec.struct. author ..eeeeeeeeee.........eeeeeeeeee....eeeeeee.....eeeeeee..eeeeeee....eeeeee.....hhhhh...eeeeeeee..eeeeee..eeeeee...............ee..................eeeeeeeeeee.....ee.hhhhh.eeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE LAM_G_DOMAIN  PDB: - UniProt: 2935-3115                                                                                                                                             - PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1qu0 D 2936 SGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCP 3116
                                  2945      2955      2965      2975      2985      2995      3005      3015      3025      3035      3045      3055      3065      3075      3085      3095      3105      3115

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Concanavalin A-like lectins/glucanases (797)

Superfamily: Concanavalin A-like lectins/glucanases (797)

Family: Laminin G-like module (37)

Protein domain: Laminin alpha2 chain (3)

Mouse (Mus musculus) [TaxId: 10090] (3)

1a	d1qu0a_	A:
1b	d1qu0b_	B:
1c	d1qu0c_	C:
1d	d1qu0d_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Jelly Rolls (1293)

Homologous Superfamily: [code=2.60.120.200, no name defined] (421)

House mouse (Mus musculus) (5)

1a	1qu0C00	C:2935-3117
1b	1qu0A00	A:2936-3116
1c	1qu0B00	B:2936-3116
1d	1qu0D00	D:2936-3116

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Concanavalin (293)

Family: Laminin_G_2 (14)

Mus musculus (Mouse) (5)

1a	Laminin_G_2-1qu0D01	D:2964-3092
1b	Laminin_G_2-1qu0D02	D:2964-3092
1c	Laminin_G_2-1qu0D03	D:2964-3092
1d	Laminin_G_2-1qu0D04	D:2964-3092

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (LAMA2_MOUSE | Q60675)

molecular function
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
biological process
	GO:0007411	axon guidance	The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0022011	myelination in peripheral nervous system	The process in which neuronal axons and dendrites become coated with a segmented lipid-rich sheath (myelin) to enable faster and more energetically efficient conduction of electrical impulses. The sheath is formed by the cell membranes of Schwann cells in the peripheral nervous system. Adjacent myelin segments are separated by a non-myelinated stretch of axon called a node of Ranvier.
	GO:0032224	positive regulation of synaptic transmission, cholinergic	Any process that activates, maintains or increases the frequency, rate or extent of cholinergic synaptic transmission, the process of communication from a neuron to another neuron across a synapse using the neurotransmitter acetylcholine.
	GO:0030155	regulation of cell adhesion	Any process that modulates the frequency, rate or extent of attachment of a cell to another cell or to the extracellular matrix.
	GO:0030334	regulation of cell migration	Any process that modulates the frequency, rate or extent of cell migration.
	GO:0045995	regulation of embryonic development	Any process that modulates the frequency, rate or extent of embryonic development.
cellular component
	GO:0005605	basal lamina	A thin sheet of proteoglycans and glycoproteins, especially laminin, secreted by cells as an extracellular matrix.
	GO:0005604	basement membrane	A thin layer of dense material found in various animal tissues interposed between the cells and the adjacent connective tissue. It consists of the basal lamina plus an associated layer of reticulin fibers.
	GO:0043197	dendritic spine	A small, membranous protrusion from a dendrite that forms a postsynaptic compartment - typically receiving input from a single presynapse. They function as partially isolated biochemical and an electrical compartments. Spine morphology is variable including "thin", "stubby", "mushroom", and "branched", with a continuum of intermediate morphologies. They typically terminate in a bulb shape, linked to the dendritic shaft by a restriction. Spine remodeling is though to be involved in synaptic plasticity.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005578	proteinaceous extracellular matrix	A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.
	GO:0042383	sarcolemma	The outer membrane of a muscle cell, consisting of the plasma membrane, a covering basement membrane (about 100 nm thick and sometimes common to more than one fiber), and the associated loose network of collagen fibers.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qu0)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1qu0
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LAMA2_MOUSE \| Q60675
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LAMA2_MOUSE \| Q60675
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	LAMA2_MOUSE \| Q60675	:	1dyk 1okq 2wjs 5ik4 5ik5 5ik7 5ik8

(no "Related Entries Specified in the PDB File" available for 1QU0)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 11)

Sites (11, 11)

SS Bonds (4, 4)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File