1QR6 - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   HUMAN MITOCHONDRIAL NAD(P)-DEPENDENT MALIC ENZYME

Authors :   Y. Xu, G. Bhargava, H. Wu, G. Loeber, L. Tong

Date :   18 Jun 99 (Deposition) - 05 Jul 99 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)

Keywords :   Four Domains, Rossmann Fold, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Xu, G. Bhargava, H. Wu, G. Loeber, L. Tong
Crystal Structure Of Human Mitochondrial Nad(P)(+)-Dependen Malic Enzyme: A New Class Of Oxidative Decarboxylases.
Structure V. 7 877 1999
PubMed-ID: 10467136 | Reference-DOI: 10.1016/S0969-2126(99)80115-4

Molecule 1 - MALIC ENZYME 2
	Chains	:	A, B
	EC Number	:	1.1.1.39
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 32)

No.	Name	Count	Type	Full Name
1	MSE	28	Mod. Amino Acid	SELENOMETHIONINE
2	NAD	4	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE

Biological Unit 1 (2, 64)

No.	Name	Count	Type	Full Name
1	MSE	56	Mod. Amino Acid	SELENOMETHIONINE
2	NAD	8	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:165 , ASN A:259 , THR A:283 , LEU A:310 , GLY A:311 , ALA A:312 , GLY A:313 , GLU A:314 , ALA A:315 , PHE A:344 , ASP A:345 , LYS A:346 , VAL A:392 , ALA A:393 , GLY A:394 , LEU A:398 , LEU A:419 , SER A:420 , ASN A:421 , GLY A:446 , GLY A:465 , ASN A:467 , HOH A:2008 , HOH A:2048 , HOH A:2275 , HOH A:2398	BINDING SITE FOR RESIDUE NAD A 601
2	AC2	SOFTWARE	HIS A:154 , LYS A:156 , GLY A:192 , ILE A:193 , ARG A:194 , ARG A:197 , ILE A:479 , LEU A:480 , ASN A:482 , ARG A:542 , ARG A:556 , HOH A:2233 , HOH A:2301 , HOH A:2302 , HOH A:2324 , HOH A:2510 , HOH A:2542 , HOH A:2631 , THR B:1243 , ASP B:1244 , ARG B:1248 , ARG B:1484	BINDING SITE FOR RESIDUE NAD A 602
3	AC3	SOFTWARE	ARG B:1165 , ASN B:1259 , THR B:1283 , GLY B:1311 , ALA B:1312 , GLY B:1313 , GLU B:1314 , ALA B:1315 , ASP B:1345 , LYS B:1346 , VAL B:1392 , ALA B:1393 , GLY B:1394 , ALA B:1395 , LEU B:1419 , SER B:1420 , ASN B:1421 , GLY B:1446 , GLY B:1465 , ASN B:1467 , HOH B:2035 , HOH B:2046 , HOH B:2093 , HOH B:2173 , HOH B:2326 , HOH B:2673	BINDING SITE FOR RESIDUE NAD B 1601
4	AC4	SOFTWARE	THR A:243 , ASP A:244 , GLY A:247 , ARG A:248 , ARG A:484 , HIS B:1154 , LYS B:1156 , GLY B:1192 , ILE B:1193 , ARG B:1194 , ARG B:1197 , ILE B:1479 , LEU B:1480 , ASN B:1482 , ARG B:1542 , ARG B:1556 , HOH B:2017 , HOH B:2129 , HOH B:2352 , HOH B:2676 , HOH B:2721	BINDING SITE FOR RESIDUE NAD B 1602

(no "SS Bond" information available for 1QR6)

Asymmetric Unit

No.	Residues
1	Asn A:421	-	Pro A:422
2	Asn B:1421	-	Pro B:1422

Asymmetric Unit (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034104	P	114	L	MAOM_HUMAN	Polymorphism	16952692	A B	P	114 1114	L
2	UniProt	VAR_050017	G	450	E	MAOM_HUMAN	Polymorphism	649224	A B	G	450 1450	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034104	P	114	L	MAOM_HUMAN	Polymorphism	16952692	A A/B	P	114 1114	L
2	UniProt	VAR_050017	G	450	E	MAOM_HUMAN	Polymorphism	649224	A A/B	G	450 1450	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MALIC_ENZYMES	PS00331	Malic enzymes signature.	MAOM_HUMAN	276-292	2	A:276-292 B:1276-1292

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MALIC_ENZYMES	PS00331	Malic enzymes signature.	MAOM_HUMAN	276-292	4	A:276-292 B:1276-1292

Asymmetric Unit (15, 30)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000321341	1a	ENSE00001948888	chr18:48405419-48405678	260	MAOM_HUMAN	-	0	0	-	-
1.2	ENST00000321341	2	ENSE00001222938	chr18:48422179-48422298	120	MAOM_HUMAN	1-36	36	2	A:23-36 B:1023-1036	14 14
1.3	ENST00000321341	3	ENSE00000996845	chr18:48434433-48434566	134	MAOM_HUMAN	37-81	45	2	A:37-81 B:1037-1081	45 45
1.4	ENST00000321341	4	ENSE00000996846	chr18:48439171-48439320	150	MAOM_HUMAN	81-131	51	2	A:81-131 B:1081-1131	51 51
1.5	ENST00000321341	5	ENSE00001151659	chr18:48442538-48442613	76	MAOM_HUMAN	131-156	26	2	A:131-156 B:1131-1156	26 26
1.6	ENST00000321341	6	ENSE00001151654	chr18:48443717-48443878	162	MAOM_HUMAN	157-210	54	2	A:157-210 B:1157-1210	54 54
1.7	ENST00000321341	7	ENSE00001151650	chr18:48444480-48444583	104	MAOM_HUMAN	211-245	35	2	A:211-245 B:1211-1245	35 35
1.8	ENST00000321341	8	ENSE00001151645	chr18:48446826-48446935	110	MAOM_HUMAN	245-282	38	2	A:245-282 B:1245-1282	38 38
1.9	ENST00000321341	9	ENSE00001151639	chr18:48447031-48447128	98	MAOM_HUMAN	282-314	33	2	A:282-314 B:1282-1314	33 33
1.10	ENST00000321341	10	ENSE00001151634	chr18:48447444-48447557	114	MAOM_HUMAN	315-352	38	2	A:315-352 B:1315-1352	38 38
1.11	ENST00000321341	11	ENSE00000950181	chr18:48450468-48450582	115	MAOM_HUMAN	353-391	39	2	A:353-391 B:1353-1391	39 39
1.12	ENST00000321341	12	ENSE00000950182	chr18:48452126-48452268	143	MAOM_HUMAN	391-438	48	2	A:391-438 B:1391-1438	48 48
1.13	ENST00000321341	13	ENSE00000950183	chr18:48458628-48458730	103	MAOM_HUMAN	439-473	35	2	A:439-473 B:1439-1473	35 35
1.14	ENST00000321341	14	ENSE00000950184	chr18:48465940-48466010	71	MAOM_HUMAN	473-496	24	2	A:473-496 B:1473-1496	24 24
1.15	ENST00000321341	15	ENSE00000950185	chr18:48466658-48466756	99	MAOM_HUMAN	497-529	33	2	A:497-529 B:1497-1529	33 33
1.16b	ENST00000321341	16b	ENSE00001605064	chr18:48473387-48474691	1305	MAOM_HUMAN	530-584	55	2	A:530-573 B:1530-1573	44 44

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:551
 aligned with MAOM_HUMAN | P23368 from UniProtKB/Swiss-Prot  Length:584

    Alignment length:551
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572 
          MAOM_HUMAN     23 EKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP  573
               SCOP domains d1qr6a2 A:23-279 Mitochondrial NAD(P)-dependent malic enzyme                                                                                                                                                                                                     d1qr6a1 A:280-573 Mitochondrial NAD(P)-dependent malic enzyme                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1qr6A01 A:23-277 Aminoacid dehydrogenase-like, N-terminal domain. Chain A                                                                                                                                                                                      1qr6A02 A:278-573 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                                                                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh.....hhhhhhhhhhhhh...........hhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.........eeee.hhh.hhhhhhhh.......eeeee..........hhhhhhhhhhhhhhhhhhhhh.hhh.eeeeeee....hhhhhhh............hhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhh....eee..hhhhhhhhhhhhhhhh.....hhhhh.eeee..hhhhhhhhhhhhhhhhh...hhhhhhhheeeee..ee............hhhhh.........hhhhhhhhhh..eeee........hhhhhhhhhhhh...eeee...hhhhh..hhhhhhhh.....eeee......ee.....ee..ee.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh..hhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MALIC_ENZYMES    ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2      Exon 1.3  PDB: A:37-81 UniProt: 37-81        -------------------------------------------------Exon 1.5  PDB: A:131-156  Exon 1.6  PDB: A:157-210 UniProt: 157-210             Exon 1.7  PDB: A:211-245           ------------------------------------Exon 1.9  PDB: A:282-314         Exon 1.10  PDB: A:315-352             Exon 1.11  PDB: A:353-391              -----------------------------------------------Exon 1.13  PDB: A:439-473          -----------------------Exon 1.15  PDB: A:497-529        Exon 1.16b  PDB: A:530-573 UniProt: 530-584  Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------Exon 1.4  PDB: A:81-131 UniProt: 81-131            -----------------------------------------------------------------------------------------------------------------Exon 1.8  PDB: A:245-282              ------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: A:391-438 UniProt: 391-438      ----------------------------------Exon 1.14  PDB: A:473-49----------------------------------------------------------------------------- Transcript 1 (2)
                1qr6 A   23 EKGKPLmLNPRTNKGmAFTLQERQmLGLQGLLPPKIETQDIQALRFHRNLKKmTSPLEKYIYImGIQERNEKLFYRILQDDIESLmPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGmGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYmGLYQKRDRTQQYDDLIDEFmKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVmSmVENGLSEQEAQKKIWmFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAmASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKmAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP  573
                                  | 32     |  42    |   52        62        72  |     82   |    92       102     | 112       122       132       142       152       162       172    |  182       192       202       212      |222       232      |242       252       262       272       282       292       302       312       322  | |  332       342|      352       362       372       382       392       402    |  412       422       432       442       452       462       472       482       492       502       512       522       532      |542       552       562       572 
                                 29-MSE   38-MSE   47-MSE                      75-MSE     86-MSE               108-MSE                                                              177-MSE                                   219-MSE             239-MSE                                                                               325-MSE           343-MSE                                                         407-MSE                                                                                                                             539-MSE                              
                                                                                                                                                                                                                                                                                                                                          327-MSE

Chain B from PDB  Type:PROTEIN  Length:551
 aligned with MAOM_HUMAN | P23368 from UniProtKB/Swiss-Prot  Length:584

    Alignment length:551
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572 
          MAOM_HUMAN     23 EKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP  573
               SCOP domains d1qr6b2 B:1023-1279 Mitochondrial NAD(P)-dependent malic enzyme                                                                                                                                                                                                  d1qr6b1 B:1280-1573 Mitochondrial NAD(P)-dependent malic enzyme                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1qr6B01 B:1023-1277 Aminoacid dehydrogenase-like, N-terminal domain. Chain A                                                                                                                                                                                   1qr6B02 B:1278-1573 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                                                                  CATH domains
           Pfam domains (1) ------------------------------------------------------------------malic-1qr6B03 B:1089-1270                                                                                                                                                             ---------Malic_M-1qr6B01 B:1280-1535                                                                                                                                                                                                                                     -------------------------------------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------malic-1qr6B04 B:1089-1270                                                                                                                                                             ---------Malic_M-1qr6B02 B:1280-1535                                                                                                                                                                                                                                     -------------------------------------- Pfam domains (2)
         Sec.struct. author ..hhhhh......hhhhhhhhhhhhh...........hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh.........eeee.hhh.hhhhhhh........eeeee..........hhhhhhhhhhhhhhhhhhhhh.hhh.eeeeeee....hhhhhhh............hhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh...eeehhhhhhhhhhhhhhhhhhh....hhhhh.eeee..hhhhhhhhhhhhhhhhh...hhhhhhhheeeee..ee............hhhhh.........hhhhhhhhh...eeee........hhhhhhhhhh.....eeee...hhhhh..hhhhhhhh.....eeee......ee.....ee..ee.hhhhhhhhhhhhhhhh......hhhhhhhhhhhhh..hhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------L-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------E--------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MALIC_ENZYMES    ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2      Exon 1.3  PDB: B:1037-1081 UniProt: 37-81    -------------------------------------------------Exon 1.5  PDB: B:1131-1156Exon 1.6  PDB: B:1157-1210 UniProt: 157-210           Exon 1.7  PDB: B:1211-1245         ------------------------------------Exon 1.9  PDB: B:1282-1314       Exon 1.10  PDB: B:1315-1352           Exon 1.11  PDB: B:1353-1391            -----------------------------------------------Exon 1.13  PDB: B:1439-1473        -----------------------Exon 1.15  PDB: B:1497-1529      Exon 1.16b  PDB: B:1530-1573 [INCOMPLETE]    Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------Exon 1.4  PDB: B:1081-1131 UniProt: 81-131         -----------------------------------------------------------------------------------------------------------------Exon 1.8  PDB: B:1245-1282            ------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: B:1391-1438 UniProt: 391-438    ----------------------------------Exon 1.14               ----------------------------------------------------------------------------- Transcript 1 (2)
                1qr6 B 1023 EKGKPLmLNPRTNKGmAFTLQERQmLGLQGLLPPKIETQDIQALRFHRNLKKmTSPLEKYIYImGIQERNEKLFYRILQDDIESLmPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGmGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYmGLYQKRDRTQQYDDLIDEFmKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVmSmVENGLSEQEAQKKIWmFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAmASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKmAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP 1573
                                  1032     |1042    | 1052      1062      1072  |   1082   |  1092      1102     |1112      1122      1132      1142      1152      1162      1172    | 1182      1192      1202      1212      1222      1232      1242      1252      1262      1272      1282      1292      1302      1312      1322  | | 1332      1342|     1352      1362      1372      1382      1392      1402    | 1412      1422      1432      1442      1452      1462      1472      1482      1492      1502      1512      1522      1532      1542      1552      1562      1572 
                               1029-MSE 1038-MSE 1047-MSE                    1075-MSE   1086-MSE              1108-MSE                                                             1177-MSE                                  1219-MSE            1239-MSE                                                                              1325-MSE          1343-MSE                                                        1407-MSE                                                                                                                            1539-MSE                              
                                                                                                                                                                                                                                                                                                                                         1327-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: Aminoacid dehydrogenase-like, N-terminal domain. Chain A (17)

Human (Homo sapiens) (11)

1a	1qr6A01	A:23-277
1b	1qr6B01	B:1023-1277

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Human (Homo sapiens) (188)

2a	1qr6A02	A:278-573
2b	1qr6B02	B:1278-1573

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: NADP_Rossmann (1239)

Family: Malic_M (9)

Homo sapiens (Human) (5)

1a	Malic_M-1qr6B01	B:1280-1535
1b	Malic_M-1qr6B02	B:1280-1535

Clan: no clan defined [family: malic] (9)

Family: malic (9)

Homo sapiens (Human) (5)

2a	malic-1qr6B03	B:1089-1270
2b	malic-1qr6B04	B:1089-1270

Asymmetric Unit(hide GO term definitions)

Chain A,B (MAOM_HUMAN | P23368)

molecular function
	GO:0051287	NAD binding	Interacting selectively and non-covalently with nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0004471	malate dehydrogenase (decarboxylating) (NAD+) activity	Catalysis of the reaction: (S)-malate + NAD+ = pyruvate + CO2 + NADH + H+.
	GO:0004470	malic enzyme activity	Catalysis of the oxidative decarboxylation of malate with the concomitant production of pyruvate.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008948	oxaloacetate decarboxylase activity	Catalysis of the reaction: oxaloacetate = pyruvate + CO2.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0006108	malate metabolic process	The chemical reactions and pathways involving malate, the anion of hydroxybutanedioic acid, a chiral hydroxydicarboxylic acid. The (+) enantiomer is an important intermediate in metabolism as a component of both the TCA cycle and the glyoxylate cycle.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:1902031	regulation of NADP metabolic process	Any process that modulates the frequency, rate or extent of NADP metabolic process.
cellular component
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asn A:421 - Pro A:422	[ RasMol ]
		Asn B:1421 - Pro B:1422	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1qr6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MAOM_HUMAN \| P23368
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.39
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MAOM_HUMAN \| P23368
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	MAOM_HUMAN \| P23368	:	1do8 1efk 1efl 1gz3 1gz4 1pj2 1pj3 1pj4 1pjl

(no "Related Entries Specified in the PDB File" available for 1QR6)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 32)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 4)

PROSITE Motifs (1, 2)

Exons (15, 30)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (2, 4)

Pfam Domains (2, 4)

Gene Ontology (15, 15)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File