|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric Unit (2, 3) Biological Unit 1 (2, 2) Biological Unit 2 (1, 1) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1QOG) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1QOG) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1QOG) |
PROSITE Motifs (2, 4)
Asymmetric Unit (2, 4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1QOG) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:98 aligned with FER1_NOSS1 | P0A3C7 from UniProtKB/Swiss-Prot Length:99 Alignment length:98 11 21 31 41 51 61 71 81 91 FER1_NOSS1 2 ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY 99 SCOP domains d1qoga_ A: 2Fe-2S ferredoxin SCOP domains CATH domains 1qogA00 A:1-98 [code=3.10.20.30, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --2FE2S_FER_2 PDB: A:3-95 UniProt: 4-96 --- PROSITE (1) PROSITE (2) ----------------------------------------2FE2S_FER------------------------------------------------- PROSITE (2) Transcript -------------------------------------------------------------------------------------------------- Transcript 1qog A 1 ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACATCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY 98 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:98 aligned with FER1_NOSS1 | P0A3C7 from UniProtKB/Swiss-Prot Length:99 Alignment length:98 11 21 31 41 51 61 71 81 91 FER1_NOSS1 2 ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY 99 SCOP domains d1qogb_ B: 2Fe-2S ferredoxin SCOP domains CATH domains 1qogB00 B:1-98 [code=3.10.20.30, no name defined] CATH domains Pfam domains (1) --------Fer2-1qogB01 B:9-84 -------------- Pfam domains (1) Pfam domains (2) --------Fer2-1qogB02 B:9-84 -------------- Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --2FE2S_FER_2 PDB: B:3-95 UniProt: 4-96 --- PROSITE (1) PROSITE (2) ----------------------------------------2FE2S_FER------------------------------------------------- PROSITE (2) Transcript -------------------------------------------------------------------------------------------------- Transcript 1qog B 1 ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACATCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY 98 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A,B (FER1_NOSS1 | P0A3C7)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|